Protein

MCA_00212_1

Length
553 amino acids

Gene name: HEM1

Description: 5-aminolevulinate synthase, mitochondrial

Browser: contigA:668093-669755-

RNA-seq: read pairs 3049, FPKM 68.0, percentile rank 71.9% (100% = highest expression)

Protein function

Annotation:HEM15-aminolevulinate synthase, mitochondrial
KEGG:K00643E2.3.1.37 5-aminolevulinate synthase [EC:2.3.1.37]
EGGNOG:0PHKAHEM15-aminolevulinate synthase
SGD closest match:S000002640HEM15-aminolevulinate synthase, mitochondrial
CGD closest match:CAL0000189686HEM15-aminolevulinate synthase, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_01291_176.06%5640.0MIA_01291_1
A0A0J9XHV1_GEOCN68.74%5630.05-aminolevulinate synthase OS=Geotrichum candidum GN=BN980_GECA19s00626g PE=3 SV=1
A0A060TF42_BLAAD63.51%5590.05-aminolevulinate synthase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20020g PE=3 SV=1
HEM1_YARLI63.25%5660.05-aminolevulinate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM1 PE=3 SV=1
UniRef50_Q6CCW063.25%5660.05-aminolevulinate synthase, mitochondrial n=37 Tax=Fungi TaxID=4751 RepID=HEM1_YARLI
A0A167DL55_9ASCO60.48%5820.05-aminolevulinate synthase OS=Sugiyamaella lignohabitans GN=HEM1 PE=3 SV=1
HEM1_CANAL58.81%5560.05-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM1 PE=3 SV=2
A0A1E3PS32_9ASCO57.97%5710.05-aminolevulinate synthase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81251 PE=3 SV=1
A0A1E4TMF0_9ASCO57.17%5580.05-aminolevulinate synthase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_95462 PE=3 SV=1
HEM1_YEAST63.27%4520.05-aminolevulinate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9241
Predicted cleavage: 34

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 553

Detailed signature matches

  1. Domain IPR015424
    Pyridoxal phosphate-dependent transferase
    1. SSF53383 (PLP-depen...)
  2. Domain IPR004839
    Aminotransferase, class I/classII
    1. PF00155 (Aminotran_1_2)
  3. Domain IPR010961
    Tetrapyrrole biosynthesis, 5-aminolevulinic acid synthase
    1. TIGR01821
  4. Domain IPR015421
    Pyridoxal phosphate-dependent transferase, major region, subdomain 1
    1. G3DSA:3.40.64...
  5. Domain IPR015422
    Pyridoxal phosphate-dependent transferase, subdomain 2
    1. G3DSA:3.90.11...
  6. SITE IPR001917
    Aminotransferase, class-II, pyridoxal-phosphate binding site
    1. PS00599 (AA_TRANSFE...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06454 (KBL_like)

Residue annotation

  1. substrate-cofactor...
  2. pyridoxal 5'-phosp...
  3. catalytic residue ...

Protein sequence

>MCA_00212_1
MDTLARQSKTLCPYIHRTSTETLRRLSAQAAITSVAKRCPIMSHAIQIREHHIDASKQVKKSHYSTIREVDLSKADPLFV
AVPNPVKKPAKASATFEGDSNTPFNYEKTYENELARKHQDKSYRYFNNINRLANKFPKAHRGSEEEEVTVWCSNDYLGMG
SNPVVVKAMHETIDKYGAGAGGTRNIAGHNKHALQLEHSLATLHKKDSALVFTSCFVANDATLALLGKKLPNAVYFSDEM
NHASMIEGIRHSGAEKVIWKHNDLKDLEEKLARYPLGQPKIIAFESVYSMSGNISPIEAICDLADKYGALTFLDEVHAVG
MYGPHGAGVAEHLDFEYHNSTGALAPERNGRDIMSRVDIITGTLGKAFGCMGGYVAGSKHFVDWVRSYAPGFIFTTSLPP
AVMSGATAAIEYQKSSLKERVAQQQNTKYVKQELAKLGIPVVPNPSHIVPVLVGNAEKAKQASDMLLEKYSIYVQAINYP
TVPIGQERLRITPTPGHNKELSDYLVKALDETFTTLKLDRVEDWAAQGGRCGVAEPGYEHAATPIWTEAQMKQ

GO term prediction

Biological Process

GO:0008152 metabolic process
GO:0009058 biosynthetic process
GO:0033014 tetrapyrrole biosynthetic process

Molecular Function

GO:0003824 catalytic activity
GO:0003870 5-aminolevulinate synthase activity
GO:0016740 transferase activity
GO:0030170 pyridoxal phosphate binding

Cellular Component

None predicted.