Protein

MCA_00060_1

Length
167 amino acids


Gene name: BNA1

Description: 3-hydroxyanthranilate 3,4-dioxygenase

Browser: contigA:151472-152122+

RNA-seq: read pairs 1468, FPKM 108.0, percentile rank 80.1% (100% = highest expression)

Protein function

Annotation:BNA13-hydroxyanthranilate 3,4-dioxygenase
KEGG:K00452HAAO 3-hydroxyanthranilate 3,4-dioxygenase [EC:1.13.11.6]
EGGNOG:0PKSRBNA1Catalyzes the oxidative ring opening of 3- hydroxyanthranilate to 2-amino-3-carboxymuconate semialdehyde, which spontaneously cyclizes to quinolinate (By similarity)
SGD closest match:S000003786BNA13-hydroxyanthranilate 3,4-dioxygenase
CGD closest match:CAL0000184857BNA13-hydroxyanthranilate 3,4-dioxygenase

Protein alignments

%idAln lengthE-value
MIA_04120_180.72%1668e-102MIA_04120_1
A0A0J9X944_GEOCN75.45%1676e-983-hydroxyanthranilate 3,4-dioxygenase OS=Geotrichum candidum GN=BNA1 PE=3 SV=1
3HAO_YARLI68.05%1696e-873-hydroxyanthranilate 3,4-dioxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BNA1 PE=3 SV=1
A0A1E3PNV5_9ASCO63.91%1696e-843-hydroxyanthranilate 3,4-dioxygenase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=BNA1 PE=3 SV=1
A0A060T9I5_BLAAD64.81%1621e-823-hydroxyanthranilate 3,4-dioxygenase OS=Blastobotrys adeninivorans GN=BNA1 PE=3 SV=1
3HAO_CANAL64.42%1639e-813-hydroxyanthranilate 3,4-dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA1 PE=3 SV=1
UniRef50_Q7SDX361.45%1662e-763-hydroxyanthranilate 3,4-dioxygenase n=87 Tax=Fungi TaxID=4751 RepID=3HAO_NEUCR
A0A1E4TDE7_9ASCO58.58%1691e-753-hydroxyanthranilate 3,4-dioxygenase OS=Tortispora caseinolytica NRRL Y-17796 GN=BNA1 PE=3 SV=1
3HAO_YEAST60.12%1632e-703-hydroxyanthranilate 3,4-dioxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0440

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 167

Detailed signature matches

    1. MF_00825 (3_HAO)
    2. PF06052 (3-HAO)
    1. SSF51182 (RmlC-like...)

Protein sequence

>MCA_00060_1
MLPDPINLPKWIKENSDLLKPPVNNFCIHRGGFTVMIVGGPNERTDYHVNQTPEWFHQIKGKMTLRVVDDGTFRDIEIGE
DEIFLLPANTPHNPVRYKDTIGLVVEQDRPEGLNDAIQWYCPNCKEVIYRREFYMSDLGTQVKQAIEEFRSNRENQKCSK
CGTYVDA

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0000334 3-hydroxyanthranilate 3,4-dioxygenase activity
GO:0005506 iron ion binding

Cellular Component

None predicted.