Protein
MIA_mt_19350953
Length
255 amino acids
Browser: mtDNA:15456-16224+
Protein function
| EGGNOG: | 0PJU9 | ATP6 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel |
|---|---|---|---|
| SGD closest match: | S000007268 | ATP6 | ATP synthase subunit a |
| CGD closest match: | CAL0000195054 | ATP6 | ATP synthase subunit a |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_mt_19351062 | 81.961% | 255 | 1.40e-132 | MCA_mt_19351062 |
| A0A0A1I5A1_GEOCN | 77.823% | 248 | 1.67e-123 | ATP synthase subunit a OS=Geotrichum candidum GN=ATP6 PE=3 SV=1 |
| A0A060RF29_BLAAD | 53.200% | 250 | 5.68e-77 | ATP synthase subunit a OS=Blastobotrys adeninivorans GN=atp6 PE=3 SV=1 |
| UniRef50_A0A060RF29 | 53.200% | 250 | 1.40e-73 | ATP synthase subunit a n=2 Tax=saccharomyceta TaxID=716545 RepID=A0A060RF29_BLAAD |
| ATP6_YARLI | 52.756% | 254 | 1.60e-75 | ATP synthase subunit a OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP6 PE=3 SV=2 |
| ATP6_YEAST | 54.331% | 254 | 8.79e-73 | ATP synthase subunit a OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP6 PE=1 SV=2 |
| ATP6_CANAL | 46.215% | 251 | 3.81e-56 | ATP synthase subunit a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP6 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1450
Protein family membership
- ATP synthase, F0 complex, subunit A (IPR000568)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00449 (ATPASE_A)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_mt_19350953 MRNMMMNSPLEQFEMNTYMSLNSSLIDLSWLSMTNFSMYSLIVFSLMMGLHTLSMNNNGIIPSKWSMGMESLYSTMQNMV YSQIGMSGQYYFPLMYVLFMFMLVSNLFSMMPYNFAIMSHLVFTVSLSAMMWLGVTMLGFSNFKLEYFGLFVPAGTSLPL VPILVIIELLSNTARSISLGLRLGSNILAGHLLLVMLGGLMFDFMSSGVMFFIVGFIPLALVLGIMCLECAMALIQAYVF SILACSYIKEAIYLH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)