Protein
MIA_06274_1
Length
342 amino acids
Browser: contig10:764057-765183-
Protein function
| EGGNOG: | 0PK3A | MAF1 | mitogen-activated protein kinase MAF1 |
|---|---|---|---|
| SGD closest match: | S000002412 | MAF1 | Repressor of RNA polymerase III transcription MAF1 |
| CGD closest match: | CAL0000185920 | MAF1 | Repressor of RNA polymerase III transcription MAF1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06427_1 | 56.740% | 319 | 3.52e-115 | MCA_06427_1 |
| A0A0J9XEN4_GEOCN | 50.526% | 285 | 2.39e-85 | Repressor of RNA polymerase III transcription MAF1 OS=Geotrichum candidum GN=BN980_GECA12s01836g PE=3 SV=1 |
| UniRef50_A0A0J9XEN4 | 50.526% | 285 | 4.89e-82 | Repressor of RNA polymerase III transcription MAF1 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XEN4_GEOCN |
| A0A060T357_BLAAD | 42.529% | 261 | 7.70e-68 | Repressor of RNA polymerase III transcription MAF1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29678g PE=3 SV=1 |
| Q6C262_YARLI | 45.276% | 254 | 1.35e-66 | Repressor of RNA polymerase III transcription MAF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F10541g PE=3 SV=1 |
| A0A167ET13_9ASCO | 61.176% | 170 | 4.71e-63 | RNA polymerase III-inhibiting protein MAF1 OS=Sugiyamaella lignohabitans GN=MAF1 PE=4 SV=1 |
| A0A1E4TKQ1_9ASCO | 63.910% | 133 | 8.42e-62 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14423 PE=4 SV=1 |
| A0A1E3PN26_9ASCO | 62.698% | 126 | 5.10e-49 | Repressor of RNA polymerase III transcription MAF1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50733 PE=4 SV=1 |
| MAF1_YEAST | 42.969% | 128 | 3.26e-34 | Repressor of RNA polymerase III transcription MAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAF1 PE=1 SV=1 |
| A0A1D8PI21_CANAL | 28.933% | 356 | 2.05e-32 | Repressor of RNA polymerase III transcription MAF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAF1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0549
Predicted cleavage: 23
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_06274_1 MGCTNLFDFFVFFFLNLLCPRQPSLIFTVAYYEELTDLDKLNSILKFETAELRVQGGVEVFSTKPQSYDRKLYRTIDKHL NSLQQDALLQYSISSDNTLSKSFSPPNSSNLALISPPSSHSDRSTLAINCQPKETNNSTSSQLQGASLPPALAFSLNSSP FGPLDQAASRKAFGYLISVLNSTHPDHDFSSLQPSDFRREPSVTSVLNTFNNLIFSVGMPLPPTLWESLDDHIGLKECAV YSHTPSDSFLNDLGPGTLWCYMWFFFNKRRKRVVYLYLTATRTHELSSSIRREHERRRRNSSSLATYPESYDEEEYDLAH VSDNEDGEYDDDDAIVGDLELE
GO term prediction
Biological Process
GO:0016480 negative regulation of transcription from RNA polymerase III promoter
Molecular Function
None predicted.
Cellular Component
None predicted.