Protein
MIA_05880_1
Length
427 amino acids
Browser: contig09:596741-598178-
Protein function
| EGGNOG: | 0PGM8 | ARP3 | Arp2 3 complex |
|---|---|---|---|
| SGD closest match: | S000003826 | ARP3 | Actin-related protein 3 |
| CGD closest match: | CAL0000184019 | ARP3 | Actin-related protein 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04479_1 | 88.222% | 433 | 0.0 | MCA_04479_1 |
| A0A0J9XDV7_GEOCN | 86.480% | 429 | 0.0 | Similar to Saccharomyces cerevisiae YJR065C ARP3 Essential component of the Arp2/3 complex OS=Geotrichum candidum GN=BN980_GECA12s01121g PE=3 SV=1 |
| A0A1E3PR79_9ASCO | 80.645% | 434 | 0.0 | Actin/actin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_69254 PE=3 SV=1 |
| A0A060T676_BLAAD | 78.837% | 430 | 0.0 | ARAD1C11726p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11726g PE=3 SV=1 |
| Q6C3K0_YARLI | 78.638% | 426 | 0.0 | YALI0E34170p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34170g PE=3 SV=1 |
| A0A1E4TLB1_9ASCO | 77.934% | 426 | 0.0 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87833 PE=3 SV=1 |
| Q59Z11_CANAL | 76.415% | 424 | 0.0 | Actin-related protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP3 PE=3 SV=1 |
| ARP3_YEAST | 71.047% | 449 | 0.0 | Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP3 PE=1 SV=1 |
| UniRef50_P47117 | 71.047% | 449 | 0.0 | Actin-related protein 3 n=449 Tax=Opisthokonta TaxID=33154 RepID=ARP3_YEAST |
| A0A167FG65_9ASCO | 83.901% | 323 | 6.46e-179 | Actin-related protein 3 OS=Sugiyamaella lignohabitans GN=ARP3 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0416
Predicted cleavage: 55
Protein family membership
- Actin family (IPR004000)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01132 (ACTINS_ACT...)
-
no IPR
Unintegrated signatures
-
-
SSF53067 (Actin-lik...)
-
cd00012 (NBD_sugar-...)
-
mobidb-lite (disord...)
Residue annotation
-
nucleotide binding...
Protein sequence
>MIA_05880_1 MANSAAPAIVMDKYVCFNYAGTGLTKLGFAGNDSPSFIFPTVIATRQTSSSTRGQAGGPGSSLSQKRGTEDLDFFIGNEA LEAASGPNYGLNYPIRHGQVENWDHMERFWENSIFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAV QAVLALAASWTSSKVVDRTLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITYFIQSLLRDRNEPDTSLKTAEK IKEGYCYVSPDIVKEFSRFDNEPERFQKYIVDQGLAGKVTVDVGYERFLAPEIFFNPEIYSSDYLTPLPNVVDAVVQASP IDVRRGLYKNIVLSGGSTMFRDFGRRLQRDIRTLVNDRIARSERLSGAKSGGLDVNVISHKKQRNAVWFGGSLLAGTAEF RNICYTKADYDELGPGIVRQFSLFNVP
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.