Protein
MIA_05623_1
Length
110 amino acids
Browser: contig08:951654-951987-
Protein function
| EGGNOG: | 0PS0T | TIM13 | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins |
|---|---|---|---|
| SGD closest match: | S000003413 | TIM13 | Mitochondrial import inner membrane translocase subunit TIM13 |
| CGD closest match: | CAL0000199188 | TIM13 | Mitochondrial import inner membrane translocase subunit TIM13 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02030_1 | 82.143% | 84 | 1.53e-47 | MCA_02030_1 |
| A0A0J9X3K8_GEOCN | 77.108% | 83 | 1.44e-45 | Similar to Saccharomyces cerevisiae YGR181W TIM13 Mitochondrial intermembrane space protein, forms a complex with Tim8p that delivers a subset of hydrophobic proteins to the TIM22 complex OS=Geotrichum candidum GN=BN980_GECA01s10724g PE=3 SV=1 |
| A0A060TDZ5_BLAAD | 67.949% | 78 | 4.20e-37 | ARAD1D11440p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11440g PE=3 SV=1 |
| A0A1E3PEM5_9ASCO | 61.364% | 88 | 1.14e-36 | Putative mitochondrial import inner membrane translocase subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83942 PE=3 SV=1 |
| UniRef50_I1BYM1 | 55.294% | 85 | 1.31e-28 | Uncharacterized protein n=6 Tax=Rhizopus TaxID=4842 RepID=I1BYM1_RHIO9 |
| Q6CA05_YARLI | 58.974% | 78 | 7.48e-32 | YALI0D06908p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06908g PE=3 SV=2 |
| TIM13_CANAL | 56.579% | 76 | 6.88e-27 | Mitochondrial import inner membrane translocase subunit TIM13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM13 PE=3 SV=2 |
| TIM13_YEAST | 47.191% | 89 | 2.40e-26 | Mitochondrial import inner membrane translocase subunit TIM13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM13 PE=1 SV=1 |
| A0A1E4TFS8_9ASCO | 52.941% | 68 | 3.05e-25 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25083 PE=3 SV=1 |
| A0A167DCN8_9ASCO | 62.857% | 35 | 2.30e-09 | Tim13p OS=Sugiyamaella lignohabitans GN=TIM13 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0504
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
110
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_05623_1 MSGITSIFGSSGSNKTDSPLATSTSFQSSAEVKRQIQEKIQQELAIANATELVNKITENCYSMCVPKPGSSLSSTEQTCT KQCMEKYMQAWNTVSRAYISRIQQASAQGL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.