Protein
MIA_05597_1
Length
222 amino acids
Browser: contig08:897201-897870-
Protein function
| EGGNOG: | 0PH0M | FG10246.1 | 60s ribosomal protein L10 |
|---|---|---|---|
| SGD closest match: | S000004065 | RPL10 | 60S ribosomal protein L10 |
| CGD closest match: | CAL0000194016 | RPL10 | Ribosomal 60S subunit protein L10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A167CD93_9ASCO | 92.342% | 222 | 1.97e-141 | Ribosomal 60S subunit protein L10 OS=Sugiyamaella lignohabitans GN=RPL10 PE=4 SV=1 |
| MCA_02006_1 | 91.441% | 222 | 5.37e-139 | MCA_02006_1 |
| A0A060TBH4_BLAAD | 88.288% | 222 | 1.16e-136 | ARAD1B07678p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07678g PE=4 SV=1 |
| A0A0J9XD06_GEOCN | 86.937% | 222 | 2.79e-133 | Similar to Saccharomyces cerevisiae YLR075W RPL10 Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s03310g PE=4 SV=1 |
| A0A1E3PQE0_9ASCO | 86.574% | 216 | 2.40e-128 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81671 PE=4 SV=1 |
| Q5AIB8_CANAL | 83.410% | 217 | 9.42e-127 | Ribosomal 60S subunit protein L10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL10 PE=4 SV=1 |
| RL10_YEAST | 83.333% | 216 | 1.71e-126 | 60S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1 |
| UniRef50_P41805 | 83.333% | 216 | 4.09e-123 | 60S ribosomal protein L10 n=252 Tax=Eukaryota TaxID=2759 RepID=RL10_YEAST |
| Q6C986_YARLI | 83.410% | 217 | 4.02e-126 | YALI0D13104p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13104g PE=4 SV=1 |
| A0A1E4TLN5_9ASCO | 80.000% | 215 | 3.73e-122 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_90082 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9619
Predicted cleavage: 26
Protein family membership
- Ribosomal protein L10e (IPR001197)
Domains and repeats
-
Domain
1
50
100
150
222
Detailed signature matches
-
-
PIRSF005590 (RPL10a...)
-
-
-
-
-
PS01257 (RIBOSOMAL_...)
-
Residue annotation
-
23S rRNA interface...
-
5S rRNA interface ...
-
putative antibioti...
-
L25 interface cd01...
-
L27 interface cd01...
Protein sequence
>MIA_05597_1 MARRPARCYRYCKNKPFPKSRYNRGVPDAKIRIYDLGRKRAEVDDFPLCVHLVSNELEQLSSEALEAARICANKYITKIS GRESFHLRIRVHPFHVLRINKMLSCAGADRLQQGMRGAWGKPQGLAARVNIGQIIISVRTKDSNKAVVIEALRRARYKFP GQQKIIISKKWGFTNLDRDVYAKRRAAGEITDDGAFVKFLTKKGNLFNSLTNFPDYNPEVSA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome