Protein
MIA_05392_1
Length
206 amino acids
Browser: contig08:326491-327219-
Protein function
| SGD closest match: | S000004718 | MED11 | Mediator of RNA polymerase II transcription subunit 11 |
|---|---|---|---|
| CGD closest match: | CAL0000188346 | MED11 | Mediator of RNA polymerase II transcription subunit 11 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05455_1 | 52.066% | 121 | 3.32e-37 | MCA_05455_1 |
| A0A0J9XIB0_GEOCN | 49.533% | 107 | 1.35e-28 | Similar to Saccharomyces cerevisiae YMR112C MED11 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA19s00802g PE=4 SV=1 |
| UniRef50_A0A0J9XIB0 | 49.533% | 107 | 2.76e-25 | Similar to Saccharomyces cerevisiae YMR112C MED11 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIB0_GEOCN |
| A0A1E3PSQ5_9ASCO | 41.803% | 122 | 1.95e-23 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49089 PE=4 SV=1 |
| Q6C590_YARLI | 33.898% | 118 | 6.48e-13 | YALI0E20053p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E20053g PE=4 SV=2 |
| MED11_CANAL | 33.333% | 102 | 3.77e-12 | Mediator of RNA polymerase II transcription subunit 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED11 PE=3 SV=1 |
| MED11_YEAST | 32.653% | 98 | 1.66e-10 | Mediator of RNA polymerase II transcription subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED11 PE=1 SV=2 |
| A0A1E4TBJ8_9ASCO | 30.108% | 93 | 9.86e-07 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134074 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1172
Protein family membership
- Mediator complex, subunit Med11 (IPR019404)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_05392_1 MKSNVFENVDLSVAPMARADVEERLDSLHRIDEQIISLLDLASTAIATLRAGKISKEPSAQREFNQATAAYYTELERTSV ALRREIRLLNDVSGDKVMPVNVVPKATAVGRQKEEAIWLSISEEKKEGGDGDDGSKQGGEKTDGDVEMTDAPKEATNTSP ADRDPSEAGLEDFVEAAAAAAAAAAGTATEVVSDERQLGKLRLITK
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex