Protein
MIA_05207_1
Length
96 amino acids
Browser: contig07:1027777-1028122+
Protein function
| EGGNOG: | 0PRHV | COA3 | Required for assembly of cytochrome c oxidase (complex IV) (By similarity) |
|---|---|---|---|
| SGD closest match: | S000007611 | COA3 | Cytochrome c oxidase assembly factor 3, mitochondrial |
| CGD closest match: | CAL0000198228 | orf19.6563.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01529_1 | 61.290% | 93 | 6.83e-41 | MCA_01529_1 |
| A0A0J9XIE8_GEOCN | 63.855% | 83 | 3.25e-38 | Similar to Saccharomyces cerevisiae YJL062W-A COA3 Mitochondrial inner membrane protein that participates in regulation of COX1 translation OS=Geotrichum candidum GN=BN980_GECA18s02210g PE=4 SV=1 |
| UniRef50_A0A0J9XIE8 | 63.855% | 83 | 6.64e-35 | Similar to Saccharomyces cerevisiae YJL062W-A COA3 Mitochondrial inner membrane protein that participates in regulation of COX1 translation n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XIE8_GEOCN |
| COA3_YARLI | 43.373% | 83 | 1.05e-23 | Cytochrome c oxidase assembly factor 3, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COA3 PE=3 SV=1 |
| A0A1D8PQV7_CANAL | 40.789% | 76 | 3.96e-21 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6563.1 PE=4 SV=1 |
| A0A1E3PPT6_9ASCO | 51.515% | 66 | 3.48e-21 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45547 PE=4 SV=1 |
| A0A060T0A6_BLAAD | 45.833% | 96 | 4.23e-15 | ARAD1C11418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11418g PE=4 SV=1 |
| COA3_YEAST | 44.595% | 74 | 1.13e-13 | Cytochrome c oxidase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5880
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_05207_1 MSAPNENGYKPILRTSRYQNPVNYTMTPAALRARKPYFWKNTIATVGLIGVVGCIYFYSLNSLVQDDFGDVPVPPISDEK LAELRRKRDEEKKADH
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.