Protein
MIA_05139_1
Length
161 amino acids
Browser: contig07:833405-833937+
Protein function
| EGGNOG: | 0PPMH | FG09434.1 | Mitotic spindle biogenesis protein Spc19 |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XHQ8_GEOCN | 33.858% | 127 | 4.41e-09 | Similar to Saccharomyces cerevisiae YDR201W SPC19 Essential subunit of the Dam1 complex (Aka DASH complex) OS=Geotrichum candidum GN=BN980_GECA17s00637g PE=4 SV=1 |
| UniRef50_A0A0J9XHQ8 | 33.858% | 127 | 9.02e-06 | Similar to Saccharomyces cerevisiae YDR201W SPC19 Essential subunit of the Dam1 complex (Aka DASH complex) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHQ8_GEOCN |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3103
Protein family membership
- DASH complex subunit Spc19 (IPR013251)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF08287 (DASH_Spc19)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_05139_1 MDTLDSCISNLSSAVSSLRSGSQALTPVCSDFTRLKTVLRTDQVFDILSNAEVAQAHADLASAIDPSITALLHKADLEIE RLERKERELISKGNLQEVRLMQMRSGQTGTAGPEPQPKPTHTSAEEPLASKDQIDEILKLQRQRDRLKYTKWQHQLAGRQ K
GO term prediction
Biological Process
GO:0008608 attachment of spindle microtubules to kinetochore
Molecular Function
None predicted.
Cellular Component
GO:0005876 spindle microtubule
GO:0042729 DASH complex