Protein
MIA_05019_1
Length
189 amino acids
Browser: contig07:476648-477218-
Protein function
| EGGNOG: | 0PN7T | SEC66 | translocation protein (Sec66) |
|---|---|---|---|
| SGD closest match: | S000000375 | SEC66 | Translocation protein SEC66 |
| CGD closest match: | CAL0000180669 | orf19.3843 | Sec63 complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04582_1 | 59.259% | 189 | 5.71e-78 | MCA_04582_1 |
| A0A0J9X7I5_GEOCN | 51.323% | 189 | 3.07e-70 | Similar to Saccharomyces cerevisiae YBR171W SEC66 Non-essential subunit of Sec63 complex (Sec63p, Sec62p,Sec66p and Sec72p) OS=Geotrichum candidum GN=BN980_GECA05s01572g PE=4 SV=1 |
| UniRef50_A0A0J9X7I5 | 51.323% | 189 | 6.28e-67 | Similar to Saccharomyces cerevisiae YBR171W SEC66 Non-essential subunit of Sec63 complex (Sec63p, Sec62p,Sec66p and Sec72p) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7I5_GEOCN |
| A0A060TAP8_BLAAD | 42.857% | 189 | 9.76e-57 | ARAD1B08536p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B08536g PE=4 SV=1 |
| A0A1E3PIM7_9ASCO | 39.665% | 179 | 2.94e-47 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_26211 PE=4 SV=1 |
| Q6C620_YARLI | 36.571% | 175 | 5.66e-39 | YALI0E13211p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E13211g PE=4 SV=1 |
| A0A161HL35_9ASCO | 37.719% | 114 | 3.86e-30 | Sec63 complex subunit SEC66 OS=Sugiyamaella lignohabitans GN=SEC66 PE=4 SV=1 |
| Q5A647_CANAL | 32.370% | 173 | 1.35e-28 | Sec63 complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3843 PE=4 SV=1 |
| SEC66_YEAST | 32.941% | 170 | 2.30e-28 | Translocation protein SEC66 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC66 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1777
Protein family membership
- Translocation protein Sec66 (IPR018624)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_05019_1 MAGKISVFTPLAYIFVIITSLVVFSSVYRRRKIQQLASLKPVYEQSFARNNYYTLKAQNEKAEKDGEKKPIPDKLISAAL IRWAGEDVRQIVKMKQAKEQLTLLHQRGSIGDVTYTKFVTNEKAIEIELQLISQEANSIKEGWANTIFSVATEVSQSDGV SARIKEASKVKEEYEKTLQKIRQRALEEL
GO term prediction
Biological Process
GO:0031204 posttranslational protein targeting to membrane, translocation
Molecular Function
None predicted.
Cellular Component
GO:0031207 Sec62/Sec63 complex