Protein
MIA_04907_1
Length
168 amino acids
Browser: contig07:138059-138687-
Protein function
| EGGNOG: | 0PNX6 | ARC18 | arp2 3 complex |
|---|---|---|---|
| SGD closest match: | S000004362 | ARC18 | Actin-related protein 2/3 complex subunit 3 |
| CGD closest match: | CAL0000196412 | ARC18 | Actin-related protein 2/3 complex subunit 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01187_2 | 87.20% | 164 | 1e-94 | MCA_01187_2 |
| A0A0J9XA07_GEOCN | 84.05% | 163 | 1e-89 | Actin-related protein 2/3 complex subunit 3 OS=Geotrichum candidum GN=BN980_GECA05s04410g PE=3 SV=1 |
| Q6CDY5_YARLI | 75.93% | 162 | 5e-82 | Actin-related protein 2/3 complex subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B20240g PE=3 SV=1 |
| A0A1E3PJ41_9ASCO | 75.00% | 164 | 1e-81 | Actin-related protein 2/3 complex subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52035 PE=3 SV=1 |
| A0A060T1J2_BLAAD | 72.46% | 167 | 1e-78 | Actin-related protein 2/3 complex subunit 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C21054g PE=3 SV=1 |
| A0A1E4TDP2_9ASCO | 65.82% | 158 | 1e-69 | Actin-related protein 2/3 complex subunit 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1620 PE=3 SV=1 |
| ARPC3_YEAST | 65.85% | 164 | 2e-63 | Actin-related protein 2/3 complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC18 PE=1 SV=1 |
| UniRef50_B6K3A2 | 59.63% | 161 | 5e-57 | Actin-related protein 2/3 complex subunit 3 n=38 Tax=Fungi TaxID=4751 RepID=B6K3A2_SCHJY |
| Q59WT0_CANAL | 58.43% | 166 | 4e-59 | Actin-related protein 2/3 complex subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC18 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2864
Protein family membership
- Actin-related protein 2/3 complex subunit 3 (IPR007204)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF016315 (p21-ARC)
-
-
SSF69060 (Arp2/3 co...)
-
PF04062 (P21-Arc)
-
Protein sequence
>MIA_04907_1 MPVRADDRVIGNFAVLPLKTKFRGPAYPCSDDYDILDEILDLFRANSFFRNFEIKGPADRTLIYGILFISDCLNKLKPTT PPNEANKILNTLAVEHFTIPGDASFPLNALYAPPRDRTEADTLRSYLTQFRQELALRLISRVYPHDAKVPNKYWLAFTRR RFMNKSLS
GO term prediction
Biological Process
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation
Molecular Function
None predicted.
Cellular Component
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex