Protein
MIA_04876_1
Length
168 amino acids
Browser: contig07:62237-62744+
Protein function
| EGGNOG: | 0PQT2 | PGUG_05352 | Protein of unknown function (DUF3128) |
|---|---|---|---|
| SGD closest match: | S000002920 | EMI1 | Early meiotic induction protein 1 |
| CGD closest match: | CAL0000192157 | orf19.3533 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04651_1 | 58.64% | 162 | 1e-72 | MCA_04651_1 |
| A0A0J9XKI8_GEOCN | 54.00% | 150 | 2e-50 | Similar to Saccharomyces cerevisiae YDR512C EMI1 Non-essential protein required for transcriptional induction of the early meiotic-specific transcription factor IME1 OS=Geotrichum candidum GN=BN980_GECA27s00769g PE=4 SV=1 |
| UniRef50_A0A0J9XKI8 | 54.00% | 150 | 4e-47 | Similar to Saccharomyces cerevisiae YDR512C EMI1 Non-essential protein required for transcriptional induction of the early meiotic-specific transcription factor IME1 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XKI8_GEOCN |
| A0A060TD38_BLAAD | 50.50% | 101 | 2e-32 | ARAD1B21208p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B21208g PE=4 SV=1 |
| A0A1E3PN95_9ASCO | 42.27% | 97 | 7e-26 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14390 PE=4 SV=1 |
| Q6CEB5_YARLI | 50.00% | 88 | 4e-24 | YALI0B16962p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B16962g PE=4 SV=1 |
| EMI1_YEAST | 33.33% | 132 | 1e-17 | Early meiotic induction protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMI1 PE=3 SV=1 |
| Q59ZI6_CANAL | 31.25% | 112 | 2e-15 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3533 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1218
Protein family membership
- Protein of unknown function DUF3128 (IPR021475)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_04876_1 MSKESDLDASLNELLKELNAEIDGTSNSPSIASGSPASTDDSSKAHYTLSSFPTEMSCSQAFDQLVACYSIGGQMRHVYR YGNISYCDGRWSKLRFCLRLKGIWDDEERAKRVSKYYMEKLAEKKKQTGSSEDVWSVRTVPVLNPFRDDLYALRDQENNS VDESSVIN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.