Protein
MIA_04577_1
Length
204 amino acids
Browser: contig06:399962-400640-
Protein function
| EGGNOG: | 0PNYS | RRS1 | Ribosome biogenesis protein |
|---|---|---|---|
| SGD closest match: | S000005820 | RRS1 | Regulator of ribosome biosynthesis |
| CGD closest match: | CAL0000188560 | RRS1 | Rrs1p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05303_1 | 75.14% | 181 | 3e-73 | MCA_05303_1 |
| A0A0J9X344_GEOCN | 66.85% | 181 | 7e-59 | Similar to Saccharomyces cerevisiae YOR294W RRS1 Essential protein that binds ribosomal protein L11 OS=Geotrichum candidum GN=BN980_GECA01s07809g PE=4 SV=1 |
| A0A060TEY2_BLAAD | 62.92% | 178 | 7e-55 | ARAD1D11572p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11572g PE=4 SV=1 |
| A0A1E3PSR2_9ASCO | 63.01% | 173 | 8e-54 | Ribosomal biogenesis regulatory protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81420 PE=4 SV=1 |
| RRS1_YEAST | 60.95% | 169 | 1e-50 | Regulator of ribosome biosynthesis OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRS1 PE=1 SV=1 |
| UniRef50_Q08746 | 60.95% | 169 | 3e-47 | Regulator of ribosome biosynthesis n=96 Tax=Saccharomycetales TaxID=4892 RepID=RRS1_YEAST |
| A0A1D8PCC8_CANAL | 60.00% | 180 | 3e-50 | Rrs1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRS1 PE=4 SV=1 |
| Q6CH61_YARLI | 59.78% | 179 | 1e-42 | YALI0A12067p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A12067g PE=4 SV=1 |
| A0A1E4TAZ2_9ASCO | 52.29% | 153 | 7e-30 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32366 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0539
Protein family membership
- Ribosomal biogenesis regulatory protein (IPR007023)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_04577_1 MTSTEQPLKTSKVDKPVPVEYDFGSLAVFDTNPLDSSKLADEATKEEYLTEVARDNIQLLIGQLLQLPIKKTTNSVSSSG TQDSTMTLFTLPAPTTQLPREKALPKEKAKTKWERFAAEKGIKKKAKDGKLVYDEESGEWVPKWGYGGLNKKLDNQWLVE LPDKPEEPEADYEDPRALNRQERKKLVKKNQKQQEKNAKRAGNY
GO term prediction
Biological Process
GO:0042254 ribosome biogenesis
Molecular Function
None predicted.
Cellular Component
GO:0005634 nucleus