Protein
MIA_04541_1
Length
99 amino acids
Browser: contig06:301897-302602+
Protein function
| EGGNOG: | 0PPTD | Mitochondrial F1F0 ATP synthase subunit F | |
|---|---|---|---|
| SGD closest match: | S000002785 | ATP17 | ATP synthase subunit f, mitochondrial |
| CGD closest match: | CAL0000183902 | ATP17 | F1F0 ATP synthase subunit f |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02877_1 | 90.426% | 94 | 4.45e-54 | MCA_02877_1 |
| A0A0J9X9B2_GEOCN | 76.768% | 99 | 1.62e-53 | Similar to Saccharomyces cerevisiae YDR377W ATP17 Subunit f of the F0 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s00967g PE=4 SV=1 |
| A0A060T291_BLAAD | 57.843% | 102 | 2.37e-36 | ARAD1A06380p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A06380g PE=4 SV=1 |
| UniRef50_M3HFB9 | 56.436% | 101 | 1.54e-29 | ATP synthase f chain, mitochondrial, putative (Fragment) n=1 Tax=Candida maltosa (strain Xu316) TaxID=1245528 RepID=M3HFB9_CANMX |
| Q6C9E6_YARLI | 58.763% | 97 | 2.83e-33 | YALI0D11814p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D11814g PE=4 SV=1 |
| A0A1E4TC53_9ASCO | 52.577% | 97 | 6.59e-32 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32632 PE=4 SV=1 |
| ATPK_YEAST | 57.447% | 94 | 3.98e-31 | ATP synthase subunit f, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP17 PE=1 SV=1 |
| A0A1D8PRM5_CANAL | 54.455% | 101 | 7.57e-30 | F1F0 ATP synthase subunit f OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP17 PE=4 SV=1 |
| A0A1E3PD52_9ASCO | 47.423% | 97 | 8.20e-24 | Putative ATP synthase f chain mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14579 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2599
Predicted cleavage: 46
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10791 (F1F0-ATPsyn_F)
-
Protein sequence
>MIA_04541_1 MSQVFKRGLSTLIPPKIASSANIGAAPNAKRMVNVVNFYKALPRGEAPAPQKASGIIGWYKAKYFDKGSSAPLLHLIIAG FLFGYANDYHFHLSHEHEH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
None predicted.
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)