Protein
MIA_04534_1
Length
87 amino acids
Browser: contig06:276594-276965+
Protein function
| EGGNOG: | 0PQS0 | RPS21 | Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability (By similarity) |
|---|---|---|---|
| SGD closest match: | S000001765 | RPS21A | 40S ribosomal protein S21-A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05893_1 | 86.207% | 87 | 1.45e-53 | MCA_05893_1 |
| A0A1E3PHV1_9ASCO | 79.310% | 87 | 2.59e-50 | 40S ribosomal protein S21 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83078 PE=3 SV=1 |
| A0A060TCG6_BLAAD | 78.161% | 87 | 3.29e-50 | 40S ribosomal protein S21 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39138g PE=3 SV=1 |
| A0A0F7RQF2_GEOCN | 79.310% | 87 | 1.56e-49 | 40S ribosomal protein S21 OS=Geotrichum candidum GN=BN980_GECA05s01726g PE=3 SV=1 |
| Q6C959_YARLI | 77.011% | 87 | 1.76e-48 | 40S ribosomal protein S21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13794g PE=3 SV=1 |
| A0A1D8PCG7_CANAL | 77.011% | 87 | 1.37e-47 | 40S ribosomal protein S21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS21B PE=3 SV=1 |
| RS21A_YEAST | 74.713% | 87 | 1.13e-45 | 40S ribosomal protein S21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS21A PE=1 SV=1 |
| UniRef50_P0C0V8 | 74.713% | 87 | 2.71e-42 | 40S ribosomal protein S21-A n=274 Tax=Eukaryota TaxID=2759 RepID=RS21A_YEAST |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0556
Protein family membership
- Ribosomal protein S21e (IPR001931)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01249 (Ribosomal_...)
-
-
PIRSF002148 (RPS21e)
-
Protein sequence
>MIA_04534_1 MENEQGVLVELYIPRKCDATNRIIKAKDHASVQINIADVDEFGRAIAGKNTTYSICGYIRSKAESDDSLNRLAQQDGLLK NVFSYRR
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome