Protein
MIA_04294_1
Length
308 amino acids
Browser: contig05:1335924-1336851-
Protein function
| EGGNOG: | 0PJWT | COX18 | Cytochrome c oxidase assembly protein |
|---|---|---|---|
| SGD closest match: | S000003294 | COX18 | Mitochondrial inner membrane protein COX18 |
| CGD closest match: | CAL0000175771 | orf19.3946 | Membrane insertase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06085_1 | 59.41% | 303 | 1e-111 | MCA_06085_1 |
| A0A060T9J7_BLAAD | 49.12% | 285 | 1e-83 | ARAD1C38390p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C38390g PE=3 SV=1 |
| UniRef50_A0A060T9J7 | 49.12% | 285 | 4e-80 | ARAD1C38390p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T9J7_BLAAD |
| A0A167F5Y0_9ASCO | 45.54% | 303 | 4e-78 | Cox18p OS=Sugiyamaella lignohabitans GN=COX18 PE=3 SV=1 |
| A0A0J9XB38_GEOCN | 53.04% | 296 | 1e-76 | Similar to Saccharomyces cerevisiae YGR062C COX18 Mitochondrial integral inner membrane protein required for membrane insertion of C-terminus of Cox2p OS=Geotrichum candidum GN=BN980_GECA07s03992g PE=3 SV=1 |
| A0A1E3PD19_9ASCO | 41.99% | 281 | 4e-65 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53453 PE=3 SV=1 |
| Q6C1U1_YARLI | 41.22% | 296 | 4e-61 | YALI0F13387p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F13387g PE=3 SV=1 |
| A0A1D8PP09_CANAL | 33.33% | 285 | 7e-37 | Membrane insertase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3946 PE=3 SV=1 |
| COX18_YEAST | 32.89% | 298 | 1e-25 | Mitochondrial inner membrane protein COX18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX18 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8003
Predicted cleavage: 17
Protein family membership
- Membrane insertase OXA1/ALB3/YidC (IPR001708)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02096 (60KD_IMP)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_04294_1 MFRLQTRRFHASAARQFDLGTLLEPVHSAVQAAQVYTGLSWHYMIPLATLAVRATTTLPVAIANRKRAQKQAELQPVLSA MTPILRARLALASTNNSRGVALTSEQIAVLATKERRRRRVELFRKYRCQAWKSIVLLPAVQMPLWIALSLVFRSMCGWSG SIGSSIPLESAFNADAFLWCTDLVSPDPYGALPILVGILGMANIEWNAINVMNRAAAPTSAASAAAAATQGPSVPRIVAN ISRVAVMGFTTMAFQAPVAVCLYWVSSSGFSLLQNLAFDRWLPLQPYTPRPPTTEFTFSHGLSSLPCK
GO term prediction
Biological Process
GO:0051205 protein insertion into membrane
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane