Protein
MIA_04285_1
Length
445 amino acids
Browser: contig05:1307065-1308403-
Protein function
| EGGNOG: | 0PNNT | NCS2 | Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with NCS6 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation (By similarity) |
|---|---|---|---|
| SGD closest match: | S000005063 | NCS2 | Cytoplasmic tRNA 2-thiolation protein 2 |
| CGD closest match: | CAL0000189560 | NCS2 | Cytoplasmic tRNA 2-thiolation protein 2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05639_1 | 33.272% | 541 | 3.12e-80 | MCA_05639_1 |
| A0A167FGG3_9ASCO | 27.312% | 465 | 5.36e-37 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Sugiyamaella lignohabitans GN=NCS2 PE=3 SV=1 |
| UniRef50_A0A167FGG3 | 27.312% | 465 | 1.47e-33 | Cytoplasmic tRNA 2-thiolation protein 2 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167FGG3_9ASCO |
| A0A060T5X9_BLAAD | 26.667% | 435 | 3.82e-27 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Blastobotrys adeninivorans GN=NCS2 PE=3 SV=1 |
| A0A1E3PDG6_9ASCO | 24.165% | 509 | 5.78e-26 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NCS2 PE=3 SV=1 |
| A0A0J9XH07_GEOCN | 40.397% | 151 | 4.80e-21 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Geotrichum candidum GN=NCS2 PE=3 SV=1 |
| CTU2_CANAL | 24.390% | 451 | 1.17e-18 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS2 PE=3 SV=2 |
| CTU2_YARLI | 20.582% | 481 | 3.73e-17 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS2 PE=3 SV=1 |
| CTU2_YEAST | 19.619% | 525 | 6.36e-17 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4600
Predicted cleavage: 50
Protein family membership
- Cytoplasmic tRNA 2-thiolation protein 2 (IPR019407)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_04285_1 MAPSKSATLGDPCSRCRPPTVSPSTALARSEPFCTKCFARFLSTKLRKQIPDYKVAYTRDKKVIPTRHHAVVPVFYSGAP SSNAAQSPVARDWVWQDSVETAAAIVLIDLLAELIREQRQKHANNQGFVLHIVVVQPSTTPEALCSLVQLLQQLYGHETE SIDQLGLDTLAGTVLDALPSRASRADALGLIARRALAQYMNKLTTDHSADNWIVAELAADPVEGVAQRILASVAKGRMNL VYHDLVDLPTASSRIIWPMKEIRTQEVSTYLDLLFASPDKSTILSLLDSSSSQSTTQQQGPAKSLSIDALLRSYFAEIES AFPSVATTVVRTVEKLADPSTCSPQILQKLSSSPSSVPQYGSCTVCGCAREAKVGEWIKKITVNEGVQEDEITPVESPET INTSLPAGPLCYGCMVMLKDSSVSTLPDWSTPRSQLSSVLSEYEL
GO term prediction
Biological Process
GO:0002098 tRNA wobble uridine modification
GO:0034227 tRNA thio-modification
Molecular Function
GO:0000049 tRNA binding
Cellular Component
None predicted.