Protein
MIA_04173_1
Length
157 amino acids
Browser: contig05:972820-973335+
Protein function
| EGGNOG: | 0PP1Z | RPS14 | 40S ribosomal protein S14 |
|---|---|---|---|
| SGD closest match: | S000000627 | RPS14A | 40S ribosomal protein S14-A |
| CGD closest match: | CAL0000196584 | RPS14B | Ribosomal 40S subunit protein S14B |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060T8I9_BLAAD | 96.875% | 128 | 2.04e-77 | ARAD1D03916p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03916g PE=3 SV=1 |
| A0A0J9XBY9_GEOCN | 95.312% | 128 | 3.00e-77 | Similar to Saccharomyces cerevisiae YCR031C RPS14A and YJL191W RPS15B, Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing OS=Geotrichum candidum GN=BN980_GECA08s04806g PE=3 SV=1 |
| MCA_00131_1 | 96.094% | 128 | 8.45e-77 | MCA_00131_1 |
| A0A1E4TLZ7_9ASCO | 84.962% | 133 | 1.64e-70 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_43349 PE=3 SV=1 |
| UniRef50_A7S2J5 | 86.260% | 131 | 8.42e-66 | Predicted protein n=11 Tax=Eukaryota TaxID=2759 RepID=A7S2J5_NEMVE |
| A0A1E3PS65_9ASCO | 82.482% | 137 | 1.03e-67 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44750 PE=3 SV=1 |
| Q6CA55_YARLI | 84.252% | 127 | 2.28e-66 | YALI0D05753p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05753g PE=3 SV=2 |
| RS14A_YEAST | 86.066% | 122 | 1.36e-64 | 40S ribosomal protein S14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS14A PE=1 SV=5 |
| A0A1D8PDT3_CANAL | 90.351% | 114 | 4.94e-63 | Ribosomal 40S subunit protein S14B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS14B PE=3 SV=1 |
| A0A167E583_9ASCO | 96.296% | 81 | 2.17e-41 | Ribosomal 40S subunit protein S14A OS=Sugiyamaella lignohabitans GN=RPS14A PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0019
Protein family membership
- Ribosomal protein S11 (IPR001971)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF00411 (Ribosomal_S11)
-
-
MF_01310 (Ribosomal...)
-
PIRSF002131 (RPS11p...)
-
-
-
PS00054 (RIBOSOMAL_S11)
-
no IPR
Unintegrated signatures
-
SSF53137 (Translati...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_04173_1 MATIPGESQQTCYLNGEVKNVTLGLQAREGELVFGVARIFASFNDTFVHVTDLSGRETISRVTGGMKVKADHDESSPYAA MLAAQDVAARCKEVGITALHFKIRATGGTGTKTPGPGAQSALRALARSGIKIGRIEDVTPVPSDSTRRKGGRRGRRL
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome