Protein
MIA_04030_1
Length
86 amino acids
Browser: contig05:556191-556599+
Protein function
| EGGNOG: | 0PRUE | VMA9 | Vacuolar atp synthase subunit |
|---|---|---|---|
| SGD closest match: | S000028508 | VMA9 | V-type proton ATPase subunit e |
| CGD closest match: | CAL0000188556 | orf19.2343.1 | H(+)-transporting V0 sector ATPase subunit e |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XKS0_GEOCN | 79.710% | 69 | 5.35e-33 | Similar to Saccharomyces cerevisiae YCL005W-A VMA9 Vacuolar H+ ATPase subunit e of the V-ATPase V0 subcomplex OS=Geotrichum candidum GN=BN980_GECA32s02760g PE=4 SV=1 |
| UniRef50_A0A0J9XKS0 | 79.710% | 69 | 1.09e-29 | Similar to Saccharomyces cerevisiae YCL005W-A VMA9 Vacuolar H+ ATPase subunit e of the V-ATPase V0 subcomplex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XKS0_GEOCN |
| MCA_02249_1 | 65.217% | 69 | 2.67e-30 | MCA_02249_1 |
| A0A1E3PLX9_9ASCO | 67.143% | 70 | 2.15e-26 | Putative secreted protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82260 PE=4 SV=1 |
| VA0E_YEAST | 62.857% | 70 | 4.65e-25 | V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 |
| A0A1D8PEY4_CANAL | 72.222% | 54 | 4.75e-23 | H(+)-transporting V0 sector ATPase subunit e OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2343.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9810
Predicted cleavage: 20
Protein family membership
- ATPase, V0 complex, subunit e1/e2 (IPR008389)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05493 (ATP_synt_H)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_04030_1 MITRRRVNMRVFPNTIYWTVIYVLLGVVAISGATWAYPFKEDKTVIRSSVILTLSMCYLMWAITFLVQLHPLVAPRRSDL RPEFAE
GO term prediction
Biological Process
GO:0015991 ATP hydrolysis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0033179 proton-transporting V-type ATPase, V0 domain