Protein
MIA_03995_1
Length
96 amino acids
Browser: contig05:452488-452831-
Protein function
| SGD closest match: | S000001957 | SAE3 | Pachytene arrest protein SAE3 |
|---|---|---|---|
| CGD closest match: | CAL0000183398 | orf19.5069 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XA00_GEOCN | 53.25% | 77 | 4e-24 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA06s04635g PE=4 SV=1 |
| UniRef50_A0A0J9XA00 | 53.25% | 77 | 7e-21 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XA00_GEOCN |
| MCA_04342_1 | 48.94% | 94 | 2e-17 | MCA_04342_1 |
| A0A1E3PEX5_9ASCO | 55.10% | 49 | 3e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47852 PE=4 SV=1 |
| A0A1D8PE61_CANAL | 40.38% | 52 | 2e-08 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5069 PE=4 SV=1 |
| SAE3_YEAST | 34.67% | 75 | 6e-07 | Pachytene arrest protein SAE3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAE3 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2722
Protein family membership
- DNA repair protein, Swi5 (IPR010760)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_03995_1 MYRRNFIKAAEPLTAEQLEKQIEEKRARLTALQEEYAELTKDLTEDPKKIVDRHIVALKKYNEIKDIALGFVSKIAEQRR QTIAQVLQEMGADITP
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.