Protein
MIA_03947_1
Length
99 amino acids
Browser: contig05:335756-336173-
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02136_1 | 40.476% | 84 | 1.49e-19 | MCA_02136_1 |
| A0A0J9XFW3_GEOCN | 38.158% | 76 | 2.64e-13 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA14s01676g PE=4 SV=1 |
| UniRef50_A0A0J9XFW3 | 38.158% | 76 | 5.40e-10 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XFW3_GEOCN |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1089
Protein family membership
- Ragulator complex protein LAMTOR5 (IPR024135)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_03947_1 MSLDLWLNETISEENVQGVLLIDKKTGLSLGCRGVAENIDAQKIKWLYDHRKHGEIFTLKHHDSVVYVTPEGDILLTIYK AASQKALSSTGSTPSLTDA
GO term prediction
Biological Process
GO:0019079 viral genome replication
GO:0043066 negative regulation of apoptotic process
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
Molecular Function
None predicted.
Cellular Component
GO:0005737 cytoplasm
GO:0071986 Ragulator complex