Protein
MIA_03839_1
Length
152 amino acids
Browser: contig05:26402-26861-
Protein function
| SGD closest match: | S000001234 | CTF8 | Chromosome transmission fidelity protein 8 |
|---|---|---|---|
| CGD closest match: | CAL0000178874 | CTF8 | Ctf8p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02144_1 | 45.62% | 160 | 3e-40 | MCA_02144_1 |
| A0A167D4L7_9ASCO | 40.59% | 170 | 1e-28 | Chromosome transmission fidelity protein 8 OS=Sugiyamaella lignohabitans GN=CTF8 PE=4 SV=1 |
| UniRef50_A0A167D4L7 | 40.59% | 170 | 4e-25 | Chromosome transmission fidelity protein 8 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167D4L7_9ASCO |
| A0A0J9X5W9_GEOCN | 37.58% | 157 | 6e-27 | Similar to Saccharomyces cerevisiae YHR191C CTF8 Subunit of a complex with Ctf18p that shares some subunits with Replication Factor C and is required for sister chromatid cohesion OS=Geotrichum candidum GN=BN980_GECA03s03970g PE=4 SV=1 |
| A0A060T590_BLAAD | 32.43% | 185 | 1e-24 | ARAD1B02772p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B02772g PE=4 SV=1 |
| Q59XA3_CANAL | 33.10% | 145 | 7e-14 | Ctf8p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTF8 PE=4 SV=1 |
| A0A1E3PEG2_9ASCO | 30.82% | 146 | 1e-12 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47642 PE=4 SV=1 |
| Q6C6Z4_YARLI | 32.06% | 131 | 3e-11 | YALI0E05071p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E05071g PE=4 SV=1 |
| CTF8_YEAST | 27.14% | 140 | 7e-07 | Chromosome transmission fidelity protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF8 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0360
Protein family membership
- Chromosome transmission fidelity protein 8 (IPR018607)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_03839_1 MPFAKLSYNFYSEEKSTTLPELLQTPSGLILIEIQGTVHIGNQTLVSSGGFGLNNLSENKCKANLIHFLGKFDFSELENK NILLTIDEHQSLHGKFVKLKKPLAILRIDQLIDTNQEIRTKSDRDPINVPLLDVIEFKVVFTSRPEPIVYIT
GO term prediction
Biological Process
GO:0007064 mitotic sister chromatid cohesion
Molecular Function
None predicted.
Cellular Component
GO:0031390 Ctf18 RFC-like complex