Protein
MIA_03683_1
Length
228 amino acids
Browser: contig04:1877575-1878262+
Protein function
| EGGNOG: | 0PQ9W | FG02762.1 | Ribosomal protein |
|---|---|---|---|
| SGD closest match: | S000005250 | MRPS18 | 37S ribosomal protein S18, mitochondrial |
| CGD closest match: | CAL0000201449 | orf19.688 | Mitochondrial 37S ribosomal protein YmS18 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XH89_GEOCN | 70.588% | 170 | 2.16e-82 | Similar to Saccharomyces cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA16s01396g PE=3 SV=1 |
| UniRef50_A0A0J9XH89 | 70.588% | 170 | 4.41e-79 | Similar to Saccharomyces cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH89_GEOCN |
| MCA_03690_1 | 60.976% | 164 | 2.66e-69 | MCA_03690_1 |
| A0A167FLY4_9ASCO | 59.236% | 157 | 7.69e-63 | Mitochondrial 37S ribosomal protein YmS18 OS=Sugiyamaella lignohabitans GN=MRPS18 PE=3 SV=1 |
| A0A060T442_BLAAD | 58.974% | 156 | 1.79e-60 | ARAD1C01672p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01672g PE=3 SV=1 |
| A0A1E3PH07_9ASCO | 46.622% | 148 | 4.31e-46 | Translational machinery component (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47291 PE=4 SV=1 |
| RT18_YEAST | 44.521% | 146 | 4.09e-38 | 37S ribosomal protein S18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS18 PE=1 SV=2 |
| Q6C5Y2_YARLI | 36.054% | 147 | 4.19e-29 | YALI0E14124p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E14124g PE=3 SV=1 |
| A0A1D8PPR6_CANAL | 38.776% | 147 | 1.23e-28 | Mitochondrial 37S ribosomal protein YmS18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.688 PE=4 SV=1 |
| A0A1E4TBM0_9ASCO | 28.049% | 164 | 9.53e-19 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20001 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9860
Predicted cleavage: 34
Protein family membership
- Ribosomal protein S11 (IPR001971)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
MF_01310 (Ribosomal...)
-
no IPR
Unintegrated signatures
-
SSF53137 (Translati...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_03683_1 MLSLRSSVARNAASAPLASRVFSRFLSDQNIKQLLDNNISRDKTTGQIAYNAFRETARSNPKVTTNKPNNKAPQSPPEPE DGKQRVGYVLHCKFTSNNTILTLTSRYVRVGKRYAKLSDEDRYMDLVRPLEDVRINLTAGILGFRHTKQGEYEAGFQTAA RMFALMSERQYLDHPLEIILSNFGKGREAFLNALNGAEGNSIRPHVTRVTDGTKIRIGGVRPPRARRV
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome