Protein
MIA_02952_1
Length
130 amino acids
Browser: contig03:2172937-2173434-
Protein function
| EGGNOG: | 0PPKG | FG07440.1 | subunit Trm112 |
|---|---|---|---|
| SGD closest match: | S000005329 | TRM112 | Multifunctional methyltransferase subunit TRM112 |
| CGD closest match: | CAL0000194338 | orf19.3585 | RNA methylation protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06515_1 | 75.97% | 129 | 2e-73 | MCA_06515_1 |
| A0A0J9XA42_GEOCN | 69.77% | 129 | 4e-67 | Similar to Saccharomyces cerevisiae YNR046W TRM112 Subunit of tRNA methyltransferase (MTase) complexes in combination with Trm9p and Trm11p OS=Geotrichum candidum GN=BN980_GECA06s03926g PE=4 SV=1 |
| A0A1E3PHW2_9ASCO | 65.12% | 129 | 2e-62 | Trm112p-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46805 PE=4 SV=1 |
| Q59Y64_CANAL | 59.23% | 130 | 2e-54 | RNA methylation protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3585 PE=4 SV=1 |
| Q6C4P5_YARLI | 58.91% | 129 | 4e-54 | YALI0E24761p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E24761g PE=1 SV=1 |
| UniRef50_C5M4X2 | 57.69% | 130 | 1e-48 | Uncharacterized protein n=1 Tax=Candida tropicalis (strain ATCC MYA-3404 / T1) TaxID=294747 RepID=C5M4X2_CANTT |
| A0A060T552_BLAAD | 56.39% | 133 | 4e-52 | ARAD1C09174p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09174g PE=4 SV=1 |
| TR112_YEAST | 50.37% | 135 | 8e-45 | Multifunctional methyltransferase subunit TRM112 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM112 PE=1 SV=1 |
| A0A1E4TD45_9ASCO | 44.96% | 129 | 3e-35 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_141963 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8774
Predicted cleavage: 16
Protein family membership
- Uncharacterised protein family UPF0434/Trm112 (IPR005651)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_02952_1 MKLMTTNFVQCAVRSCAKTSDAFPLKYSEVQMVQQEVDFEPEFLLGLLPRLDWPNLVKVCEELGNTSLPKDKPDIEDAES EESLEFLKNLHNLLIETQITEGNMTCRNCGHTYYINNSIPNFLLPPHLAN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.