Protein
MIA_02746_1
Length
374 amino acids
Browser: contig03:1636031-1637156-
Protein function
| EGGNOG: | 0PJMN | CDC123 | cell division cycle protein |
|---|---|---|---|
| SGD closest match: | S000004205 | CDC123 | Cell division cycle protein 123 |
| CGD closest match: | CAL0000179097 | CDC123 | Cell division cycle protein 123 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_03175_1 | 57.681% | 345 | 8.29e-134 | MCA_03175_1 |
| A0A0J9X3Q7_GEOCN | 51.841% | 353 | 2.83e-114 | Similar to Saccharomyces cerevisiae YLR215C CDC123 Protein involved in nutritional control of the cell cycle OS=Geotrichum candidum GN=BN980_GECA02s01440g PE=4 SV=1 |
| UniRef50_A0A0J9X3Q7 | 51.841% | 353 | 5.79e-111 | Similar to Saccharomyces cerevisiae YLR215C CDC123 Protein involved in nutritional control of the cell cycle n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X3Q7_GEOCN |
| A0A1E3PRY4_9ASCO | 48.138% | 376 | 1.55e-110 | D123-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48845 PE=4 SV=1 |
| A0A060TA17_BLAAD | 49.853% | 339 | 6.88e-110 | Cell division cycle protein 123 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41382g PE=3 SV=1 |
| A0A167C6R5_9ASCO | 46.154% | 377 | 4.49e-108 | Cdc123p OS=Sugiyamaella lignohabitans GN=CDC123 PE=4 SV=1 |
| CD123_YEAST | 41.618% | 346 | 1.01e-91 | Cell division cycle protein 123 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC123 PE=1 SV=1 |
| CD123_YARLI | 48.171% | 328 | 4.50e-91 | Cell division cycle protein 123 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CDC123 PE=3 SV=1 |
| CD123_CANAL | 36.950% | 341 | 3.74e-66 | Cell division cycle protein 123 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC123 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0397
Protein family membership
- Cell division cycle protein 123 (IPR009772)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF07065 (D123)
-
PIRSF007807 (CDC123)
-
Protein sequence
>MIA_02746_1 MPGLINSPTSESDPDSVSFPLIFKSHIDNCQFSSWHPLYSKLTPKTKILTNLPDSFVEYLLEDGIILPPDDNELTPKIQD LSISDDIANYSDDGSEPPEDPTVKFPELHLQIKTAIESLGGAVLPKLNWSAPKDASWISINNTLKCTSPSDIYLLLKSSA YITHDLTEPYSNTVEATQTTNENEDTSVKPELVLRQWFNLNPALEFRCFVRDRTLVAVSQRDYLKYYPFLDKLKDTLADE IAFFFTENIKDTFPDDSFVFDVYIPNPYDRVYLIDINPFAPQTDPLLFTWYEILHKLDPKEIDEDFELRLVDKTGATSDL LGGALQHSENRVPKDIVDASMTGAGMAELARQWNAMLSGEKISDSEDDDDTEEN
GO term prediction
Biological Process
GO:0007049 cell cycle
Molecular Function
None predicted.
Cellular Component
None predicted.