Protein
MIA_02629_1
Length
173 amino acids
Browser: contig03:1300102-1300690-
Protein function
| EGGNOG: | 0PP5V | FG09547.1 | NADH-ubiquinone oxidoreductase 20.8 kDa subunit |
|---|---|---|---|
| CGD closest match: | CAL0000189366 | CAALFM_CR02620CA | NADH-ubiquinone oxidoreductase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04194_1 | 92.486% | 173 | 3.87e-124 | MCA_04194_1 |
| A0A0J9X8Y6_GEOCN | 80.347% | 173 | 2.09e-107 | NADH-ubiquinone oxidoreductase OS=Geotrichum candidum GN=BN980_GECA05s05884g PE=3 SV=1 |
| A0A060SWX7_BLAAD | 73.684% | 171 | 8.23e-97 | NADH-ubiquinone oxidoreductase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08998g PE=3 SV=1 |
| A0A161HG64_9ASCO | 71.512% | 172 | 3.72e-90 | NADH-ubiquinone oxidoreductase OS=Sugiyamaella lignohabitans GN=AWJ20_2275 PE=3 SV=1 |
| Q6CGB4_YARLI | 67.925% | 159 | 6.31e-81 | NADH-ubiquinone oxidoreductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A20680g PE=3 SV=2 |
| UniRef50_R1GCL1 | 68.667% | 150 | 2.76e-76 | NADH-ubiquinone oxidoreductase n=8 Tax=leotiomyceta TaxID=716546 RepID=R1GCL1_BOTPV |
| A0A1E4THC3_9ASCO | 62.874% | 167 | 1.43e-76 | NADH-ubiquinone oxidoreductase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_117615 PE=3 SV=1 |
| Q5A222_CANAL | 53.896% | 154 | 9.37e-58 | NADH-ubiquinone oxidoreductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR02620CA PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0487
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF017016 (NDUA8)
-
no IPR
Unintegrated signatures
-
PS51808 (CHCH)
Protein sequence
>MIA_02629_1 MSGREVVNDHHLLIDKTPLPDHIPQVPEVGATTAPLLSASFFIGARCLPYNDDYMLCKKESNGNGEIDCLKEGRRVTRCA ISVLEDINKHCLEEFRLHWQCLEQQNHQFSGCRPAERLLNKCVFDKLKLEKTIPGTPEGQVPIHLKEKPIIRPNAEDYAS VKAYQKAKADGLL
GO term prediction
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
Molecular Function
None predicted.
Cellular Component
GO:0005747 mitochondrial respiratory chain complex I