Protein
MIA_02527_1
Length
117 amino acids
Browser: contig03:1051527-1051938+
Protein function
| EGGNOG: | 0PP96 | MRP2 | mitochondrial 37S ribosomal protein MRP2 |
|---|---|---|---|
| SGD closest match: | S000006370 | MRP2 | 37S ribosomal protein MRP2, mitochondrial |
| CGD closest match: | CAL0000191348 | MRP2 | Mitochondrial 37S ribosomal protein MRP2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02997_1 | 82.906% | 117 | 1.11e-70 | MCA_02997_1 |
| A0A0J9XK78_GEOCN | 80.342% | 117 | 1.30e-70 | Similar to Saccharomyces cerevisiae YPR166C MRP2 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA26s00065g PE=4 SV=1 |
| A0A060T8M5_BLAAD | 65.812% | 117 | 1.22e-56 | ARAD1D04664p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04664g PE=4 SV=1 |
| UniRef50_A0A0P1KZC6 | 60.526% | 114 | 1.10e-42 | LAQU0S20e01332g1_1 n=2 Tax=Lachancea TaxID=300275 RepID=A0A0P1KZC6_9SACH |
| A0A1E3PSS2_9ASCO | 63.636% | 99 | 2.39e-43 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81428 PE=4 SV=1 |
| Q5AJZ7_CANAL | 55.556% | 117 | 7.38e-43 | Mitochondrial 37S ribosomal protein MRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRP2 PE=4 SV=1 |
| RT02_YEAST | 54.386% | 114 | 1.10e-42 | 37S ribosomal protein MRP2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP2 PE=1 SV=1 |
| A0A1E4TLV0_9ASCO | 53.922% | 102 | 7.33e-38 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_19213 PE=4 SV=1 |
| Q6C892_YARLI | 42.222% | 90 | 1.95e-24 | YALI0D21626p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D21626g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0169
Predicted cleavage: 12
Protein family membership
- Ribosomal protein S14 (IPR001209)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF57716 (Glucocort...)
Protein sequence
>MIA_02527_1 MPPRFPGFTRAHVPGGEWVKTRMVRDNFKRAKVAEEEVTRTSLRYISRNTTLPMRTRIEAQLQLVSMPNYTRMTQVKNRC VDSGYARSVIKEFRLCRMKFREKALAGELPGVKKASW
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome