Protein
MIA_02413_1
Length
125 amino acids
Browser: contig03:733018-733576+
Protein function
| EGGNOG: | 0PQR4 | PFY1 | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations (By similarity) |
|---|---|---|---|
| SGD closest match: | S000005648 | PFY1 | Profilin |
| CGD closest match: | CAL0000200755 | PFY1 | Profilin |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X598_GEOCN | 44.800% | 125 | 6.51e-38 | Profilin OS=Geotrichum candidum GN=BN980_GECA03s00923g PE=3 SV=1 |
| UniRef50_P39825 | 43.307% | 127 | 1.95e-32 | Profilin n=30 Tax=Ascomycota TaxID=4890 RepID=PROF_SCHPO |
| A0A060T3S8_BLAAD | 43.651% | 126 | 2.28e-35 | Profilin OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39402g PE=3 SV=1 |
| W0TYP0_YARLI | 42.857% | 126 | 1.95e-35 | Profilin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07183g PE=3 SV=1 |
| A0A1E3PM99_9ASCO | 43.651% | 126 | 4.46e-35 | Profilin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50487 PE=3 SV=1 |
| MCA_01864_1 | 42.400% | 125 | 7.93e-35 | MCA_01864_1 |
| Q5A786_CANAL | 42.063% | 126 | 2.08e-33 | Profilin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFY1 PE=3 SV=1 |
| PROF_YEAST | 39.683% | 126 | 2.71e-32 | Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFY1 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6747
Predicted cleavage: 25
Protein family membership
- Profilin (IPR005455)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Residue annotation
-
poly-proline bindi...
-
actin interaction ...
-
putative PIP2-inte...
Protein sequence
>MIA_02413_1 MALIGYIDTLAQSHIARSAIISRDGSSIWAISSDFKLSPTEMSEIAQAFDNPAKVLGSGVHANGQKFFTLSVDDRIIRAQ MQNKGIIAIRTKQAILISNYDEKIIPVQAATVTERLADYLIGLNY
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.