Protein
MIA_02315_1
Length
109 amino acids
Browser: contig03:451287-451671-
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05387_1 | 67.347% | 49 | 7.49e-19 | MCA_05387_1 |
| A0A060SY57_BLAAD | 50.000% | 58 | 8.86e-15 | ARAD1A18150p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A18150g PE=4 SV=1 |
| UniRef50_A0A060SY57 | 50.000% | 58 | 2.19e-11 | ARAD1A18150p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SY57_BLAAD |
| Q6CC62_YARLI | 58.140% | 43 | 1.29e-12 | YALI0C12166p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C12166g PE=4 SV=2 |
| A0A0J9X4P5_GEOCN | 56.818% | 44 | 6.77e-12 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA02s05697g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0053
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_02315_1 MTSYLNDRRNSIGSISTSASSTVAAAAAATASNTFDSSAYYNNSNNNSLGTSPGSDIYYNQSSHFNPSSSPGERWWVGGK AFDGRERYYRLEPFRRKSFDRVSFDRISI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.