Protein
MIA_02166_1
Length
65 amino acids
Browser: contig03:41408-41705+
Protein function
| EGGNOG: | 0PRZK | ATP18 | K02142 F-type H -transporting ATPase subunit j EC 3.6.3.14 |
|---|---|---|---|
| SGD closest match: | S000007247 | ATP18 | ATP synthase subunit J, mitochondrial |
| CGD closest match: | CAL0000182581 | ATP18 | F1F0 ATP synthase subunit i |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06470_1 | 83.077% | 65 | 5.24e-38 | MCA_06470_1 |
| A0A0J9X854_GEOCN | 70.769% | 65 | 1.36e-30 | Similar to Saccharomyces cerevisiae YML081C-A ATP18 Subunit of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s00070g PE=4 SV=1 |
| Q6C8S0_YARLI | 56.452% | 62 | 1.06e-20 | YALI0D17490p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17490g PE=4 SV=2 |
| UniRef50_G3AKL2 | 52.632% | 57 | 2.04e-15 | Subunit I/j of mitochondrial ATP synthase n=23 Tax=Saccharomycetales TaxID=4892 RepID=G3AKL2_SPAPN |
| A0A1D8PG50_CANAL | 58.182% | 55 | 1.48e-17 | F1F0 ATP synthase subunit i OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP18 PE=4 SV=1 |
| A0A1E4TA79_9ASCO | 61.538% | 52 | 1.52e-17 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27301 PE=4 SV=1 |
| ATP18_YEAST | 54.717% | 53 | 8.28e-17 | ATP synthase subunit J, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP18 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6632
Protein family membership
- ATP synthase, F0 complex, subunit J (IPR006995)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04911 (ATP-synt_J)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_02166_1 MAFFSSFKKYPTPVLKPLWPFFAGAVVVTYLVSLGAKASMNSAEFINDPRHPRFIAGGKIQKEEH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)