Protein
MIA_02048_1
Length
212 amino acids
Browser: contig02:2466649-2467288-
Protein function
| EGGNOG: | 0PM5F | FG07288.1 | Golgi membrane protein rer1 |
|---|---|---|---|
| SGD closest match: | S000000507 | RER1 | Protein RER1 |
| CGD closest match: | CAL0000192651 | orf19.7202 | Protein retreival receptor |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060TFW7_BLAAD | 65.327% | 199 | 4.64e-76 | ARAD1D17952p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17952g PE=4 SV=1 |
| MCA_04709_1 | 62.802% | 207 | 1.26e-75 | MCA_04709_1 |
| A0A161HMJ0_9ASCO | 59.615% | 208 | 3.50e-72 | Rer1p OS=Sugiyamaella lignohabitans GN=RER1 PE=4 SV=1 |
| UniRef50_A0A161HMJ0 | 59.615% | 208 | 9.62e-69 | Rer1p n=98 Tax=Opisthokonta TaxID=33154 RepID=A0A161HMJ0_9ASCO |
| A0A0J9XL77_GEOCN | 55.760% | 217 | 3.28e-70 | Similar to Saccharomyces cerevisiae YCL001W RER1 Protein involved in retention of membrane proteins OS=Geotrichum candidum GN=BN980_GECA26s00769g PE=4 SV=1 |
| A0A1D8PRG8_CANAL | 58.911% | 202 | 7.28e-67 | Protein retreival receptor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7202 PE=4 SV=1 |
| RER1_YEAST | 53.093% | 194 | 1.41e-65 | Protein RER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RER1 PE=1 SV=2 |
| A0A1E3PQH8_9ASCO | 53.623% | 207 | 5.12e-64 | Protein RER1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45627 PE=4 SV=1 |
| Q6CFF7_YARLI | 52.885% | 208 | 1.90e-63 | YALI0B07425p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07425g PE=4 SV=1 |
| A0A1E4T9S7_9ASCO | 51.942% | 206 | 1.13e-58 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_46366 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1397
Protein family membership
- Retrieval of early ER protein Rer1 (IPR004932)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF03248 (Rer1)
-
PIRSF016013 (AtER_R...)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_02048_1 MDDIVDSVPPKLRKYFQLYQSYLDRSVPHVGARWAIFGGLLVTFMLRIVVAQGWYIVCYALGIYLLNLFLLFLQPKFDPS LEQEERREETQAAESLEEGAETGPSTSGASFDGIPNATSSSTYDRDQDDYRANEFRPFIRRLPEFKFWYNGIRATIAALV CSLFDFFDIPVFWPILLMYFIVLFVLTMRRQLQHMLKYRYLPFDLGKAKYNK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane