Protein
MIA_01950_1
Length
166 amino acids
Browser: contig02:2170635-2171191+
Protein function
| EGGNOG: | 0PR1N | GIM5 | prefoldin subunit 5 |
|---|---|---|---|
| SGD closest match: | S000004559 | GIM5 | Prefoldin subunit 5 |
| CGD closest match: | CAL0000194812 | GIM5 | Gim5p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A1E3PSM9_9ASCO | 42.958% | 142 | 4.86e-35 | Prefoldin alpha subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39658 PE=4 SV=1 |
| UniRef50_A0A0E9N9Z9 | 43.537% | 147 | 3.44e-31 | Uncharacterized protein n=2 Tax=Ascomycota TaxID=4890 RepID=A0A0E9N9Z9_9ASCO |
| MCA_01237_1 | 44.521% | 146 | 7.27e-34 | MCA_01237_1 |
| A0A0J9XG68_GEOCN | 43.357% | 143 | 4.32e-33 | Similar to Saccharomyces cerevisiae YML094W GIM5 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin OS=Geotrichum candidum GN=BN980_GECA14s01968g PE=3 SV=1 |
| A0A060T2M3_BLAAD | 38.194% | 144 | 7.72e-31 | ARAD1C33638p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33638g PE=4 SV=1 |
| A0A1E4TAR5_9ASCO | 35.664% | 143 | 2.97e-28 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32320 PE=3 SV=1 |
| PFD5_YEAST | 36.765% | 136 | 1.43e-25 | Prefoldin subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM5 PE=1 SV=1 |
| Q5AA13_CANAL | 36.620% | 142 | 1.54e-24 | Gim5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIM5 PE=4 SV=1 |
| Q6C7S5_YARLI | 37.500% | 120 | 5.43e-21 | YALI0D25740p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D25740g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0156
Protein family membership
- Prefoldin alpha-like (IPR004127)
- Prefoldin alpha subunit, archaea-type (IPR011599)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02996 (Prefoldin)
-
no IPR
Unintegrated signatures
Residue annotation
-
prefoldin alpha/be...
Protein sequence
>MIA_01950_1 MSLPSTQIDVKDLSLAQLKEVQMQLQNEVNHLQDSLEQLLMVQSRFRECAGSVEQLTGGKHPAQGGQPILVPLTSSLYVP GKIPADQTPENSTFMVDVGTGYYVEKNGAEAKEFFLAKTQKLDENMKDLKKIIEDKVKNFNVIQTVMKEKIIEQQQQQAQ AKKASA
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex