Protein
MIA_01904_1
Length
73 amino acids
Browser: contig02:2032693-2033162-
Protein function
| EGGNOG: | 0PTDK | FG07465.1 | NA |
|---|---|---|---|
| CGD closest match: | CAL0000201932 | orf19.216.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00961_1 | 81.818% | 55 | 3.40e-31 | MCA_00961_1 |
| A0A0J9XB57_GEOCN | 76.923% | 52 | 2.99e-25 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA08s00362g PE=4 SV=1 |
| A0A060TDL7_BLAAD | 56.364% | 55 | 5.04e-17 | ARAD1D44924p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D44924g PE=4 SV=1 |
| UniRef50_J4GHF8 | 59.184% | 49 | 7.09e-13 | Uncharacterized protein n=8 Tax=Basidiomycota TaxID=5204 RepID=J4GHF8_9APHY |
| A0A1D8PIC2_CANAL | 46.552% | 58 | 5.65e-12 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.216.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5556
Predicted cleavage: 45
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_01904_1 MGASHGHYKPYGPVPFPHVAKSHRFISKFLGATMWFWIFYRVREDGGVILGLRHPWDHGSGHHEIEEGKEEHH
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005743 mitochondrial inner membrane
GO:0005747 mitochondrial respiratory chain complex I