Filter view on
Entry type
Status
Per-residue features
Colour by
Protein
MIA_01865_1
Length
551 amino acids
Browser: contig02:1910953-1912609-
Protein function
| EGGNOG: | 0PJKR | PGUG_05418 | transporter |
|---|---|---|---|
| SGD closest match: | S000005069 | ESBP6 | Uncharacterized transporter ESBP6 |
| CGD closest match: | CAL0000197279 | orf19.4337 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01296_1 | 62.385% | 436 | 0.0 | MCA_01296_1 |
| UniRef50_A2RAW8 | 33.544% | 474 | 6.47e-85 | Aspergillus niger contig An18c0160, genomic contig n=15 Tax=leotiomyceta TaxID=716546 RepID=A2RAW8_ASPNC |
| A0A1E3PRR6_9ASCO | 36.318% | 402 | 4.48e-82 | MFS general substrate transporter OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48771 PE=4 SV=1 |
| A0A1D8PNK9_CANAL | 35.766% | 411 | 2.78e-73 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4337 PE=4 SV=1 |
| Q6C0D7_YARLI | 34.466% | 412 | 6.02e-73 | YALI0F25619p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F25619g PE=4 SV=1 |
| A0A0J9XJQ7_GEOCN | 35.071% | 422 | 4.60e-69 | Similar to Saccharomyces cerevisiae YNL125C ESBP6 Protein with similarity to monocarboxylate permeases OS=Geotrichum candidum GN=BN980_GECA20s00164g PE=4 SV=1 |
| ESBP6_YEAST | 29.111% | 450 | 1.30e-63 | Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 |
| A0A1E4TCK1_9ASCO | 27.603% | 413 | 1.22e-55 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32724 PE=4 SV=1 |
| A0A060TFW4_BLAAD | 26.733% | 404 | 3.11e-35 | ARAD1D17842p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17842g PE=4 SV=1 |
| A0A167FRE1_9ASCO | 28.250% | 400 | 4.11e-28 | Mch5p OS=Sugiyamaella lignohabitans GN=MCH5 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0263
Protein family membership
None predicted.
Domains and repeats
-
Domain105 - 502
- Major facilitator superfamily domain (IPR020846)
1
100
200
300
400
500
551
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)183 - 188380 - 390245 - 250302 - 325443 - 453501 - 5511 - 119
-
318 - 517100 - 312
-
NON_CYTOPLASM... (N...)212 - 222410 - 414271 - 281144 - 162349 - 359474 - 478
-
252 - 274326 - 348160 - 182413 - 435123 - 145189 - 208479 - 501386 - 408450 - 472279 - 301223 - 245
-
TRANSMEMBRANE (Tran...)479 - 500251 - 270415 - 442454 - 473189 - 211360 - 379326 - 348282 - 301120 - 143223 - 244391 - 409163 - 182
-
mobidb-lite (disord...)92 - 1121 - 27
Residue annotation
-
putative substrate...136Wputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)139Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)140Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)141Aputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)143Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)144Vputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)167Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)170Qputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)171Fputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)174Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)178Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)179Pputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)181Vputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)182Vputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)229Iputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)230Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)233Fputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)234Vputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)237Nputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)238Aputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)241Pputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)252Yputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)253Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)256Tputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)257Cputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)263Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)336Tputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)339Cputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)340Yputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)343Vputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)344Lputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)347Mputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)361Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)365Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)369Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)372Iputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)376Rputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)424Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)427Vputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)428Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)431Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)435Pputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)436Pputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)439Aputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)450Mputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)451Mputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)454Sputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)455Wputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)458Iputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)459Gputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)462Nputative substrate translocation pore
136W, 139S, 140G, 141A, 143G, 144V, 167G, 170Q, 171F, 174G, 178S, 179P, 181V, 182V, 229I, 230G, 233F, 234V, 237N, 238A, 241P, 252Y, 253G, 256T, 257C, 263S, 336T, 339C, 340Y, 343V, 344L, 347M, 361G, 365S, 369S, 372I, 376R, 424G, 427V, 428S, 431S, 435P, 436P, 439A, 450M, 451M, 454S, 455W, 458I, 459G, 462N
CDD
cd06174 (MFS)
Protein sequence
>MIA_01865_1 MSSPLKEKSIEVTINVPQPTSSQEKEGHMSDTFYCGETGSNLNLSVTATHRHHHLHNTISNVDYGAAETMLMEGQDLSGH ISPTASNIRCSREDTEAGGATVANSTEEDEEPELEFDHGYAWVVLIAGTLINAFSWGASGAFGVFLATFLDTNKYPGATR MDFAFVGGLQFGLGLMVSPFVVQAIQKVSFTVFIIAGSFVLAGGNIAASFATRIWHLYLTQGLLSGVGIGMVFVTANAAV PMWFVQRRGVAYGIFTCGAGLGSIIFSLSVQSLIDRVGLAWAQRYVGFMTFGFCVFSGIFIKERRSVYKSRGANAYNFAL LKRPDLLLAIFWGIITMLCYGIVLYTMAPYAVSVGLTHHQGSVLSSVVSAGIVVGRPVMGYCADKIGSLNIALVTTVLST IFILAWWIPSKSYGSLIALSFCLGSVVSSFSAGFPPICASLVDLEDLSAMMSMSWTVIGALNVFSTPVAIGLTTVNDTYL YSQIFTGLLFFVSSVILIVIRGIEFRIQERENQMAEKSICTSTSCTDEGCNEIKEVKQASFISLMFKIAKV
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.