Protein
MIA_01853_1
Length
266 amino acids
Browser: contig02:1881112-1881913-
Protein function
| EGGNOG: | 0PGPW | RPS0 | Required for the assembly and or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA- precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits (By similarity) |
|---|---|---|---|
| SGD closest match: | S000004038 | RPS0B | 40S ribosomal protein S0-B |
| CGD closest match: | CAL0000191976 | RPS0 | 40S ribosomal protein S0 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X8F1_GEOCN | 81.281% | 203 | 6.85e-114 | 40S ribosomal protein S0 OS=Geotrichum candidum GN=RPS0 PE=3 SV=1 |
| A0A060T537_BLAAD | 78.431% | 204 | 1.77e-111 | 40S ribosomal protein S0 OS=Blastobotrys adeninivorans GN=RPS0 PE=3 SV=1 |
| RSSA_CANAL | 77.387% | 199 | 6.42e-107 | 40S ribosomal protein S0 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS0 PE=2 SV=2 |
| UniRef50_O42817 | 77.387% | 199 | 1.56e-103 | 40S ribosomal protein S0 n=106 Tax=Eukaryota TaxID=2759 RepID=RSSA_CANAL |
| A0A1E3PIC8_9ASCO | 77.228% | 202 | 2.31e-106 | 40S ribosomal protein S0 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=RPS0 PE=3 SV=1 |
| RSSA2_YEAST | 73.869% | 199 | 4.81e-103 | 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS0B PE=1 SV=2 |
| RSSA_YARLI | 76.000% | 200 | 3.87e-100 | 40S ribosomal protein S0 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS0 PE=3 SV=2 |
| A0A1E4TF40_9ASCO | 71.429% | 203 | 1.11e-99 | 40S ribosomal protein S0 OS=Tortispora caseinolytica NRRL Y-17796 GN=RPS0 PE=3 SV=1 |
| A0A167CIV1_9ASCO | 82.286% | 175 | 5.93e-98 | 40S ribosomal protein S0 OS=Sugiyamaella lignohabitans GN=RPS0A PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0177
Protein family membership
- Ribosomal protein S2 (IPR001865)
- Ribosomal protein S2, eukaryotic/archaeal (IPR005707)
- Ribosomal protein S2, eukaryotic (IPR027498)
- Ribosomal protein S2, eukaryotic/archaeal (IPR005707)
Domains and repeats
-
Domain
1
50
100
150
200
266
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Residue annotation
-
rRNA interaction s...
-
S8 interaction sit...
-
putative laminin-1...
Protein sequence
>MIA_01853_1 MSDIFNLTPEDAQLLLAAGVHLGSKNKVVNMESYIHATRPDGVNIINISKTWEKIVLAARVIAAVPNAADVVAISARIYG QRAVLKFASHTGATAIAGRFTPGSFTNYNTRSFKEPRLIVVTDTRLDAQAIKESSYVNIPVIALCDVDSPVEYVDVAIPC NNRSKNAVGLVWWLISREVLRLKGILPDRQTQWNVMPDLYFYRDPEEPETTTVTEEEPAEEFVAEVAATTEEWDAAAAVD ASGDWAAADDWASESAPVAPTPATAA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome
GO:0015935 small ribosomal subunit