Protein
MIA_01642_1
Length
120 amino acids
Browser: contig02:1285491-1285854-
Protein function
| SGD closest match: | S000000324 | CBP6 | Cytochrome B pre-mRNA-processing protein 6 |
|---|---|---|---|
| CGD closest match: | CAL0000190781 | orf19.2201 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00316_1 | 78.992% | 119 | 1.18e-53 | MCA_00316_1 |
| A0A0J9XHZ1_GEOCN | 60.870% | 115 | 1.55e-39 | Similar to Saccharomyces cerevisiae YBR120C CBP6 Mitochondrial protein required for translation of the COB mRNA OS=Geotrichum candidum GN=BN980_GECA17s01990g PE=4 SV=1 |
| UniRef50_A0A0J9XHZ1 | 60.870% | 115 | 3.18e-36 | Similar to Saccharomyces cerevisiae YBR120C CBP6 Mitochondrial protein required for translation of the COB mRNA n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHZ1_GEOCN |
| Q5A2K4_CANAL | 34.188% | 117 | 3.23e-11 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2201 PE=4 SV=1 |
| A0A1E3PIP3_9ASCO | 29.126% | 103 | 5.77e-10 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83311 PE=4 SV=1 |
| CBP6_YEAST | 39.623% | 53 | 1.74e-07 | Cytochrome B pre-mRNA-processing protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBP6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1669
Protein family membership
None predicted.
Domains and repeats
None predicted.
Protein sequence
>MIA_01642_1 MAAYPPTTSSIKALLATFQKWTPDSLKRYASFRDFSVQRYEALLAGSQSSLNAQALAARARAADTLQKNTNKNTFVVTDR LLRPASNPIYYERLCRELAPGQPKTPMLTAIRHVIFGGYD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.