Protein
MIA_01539_1
Length
195 amino acids
Browser: contig02:1020324-1020956-
Protein function
| EGGNOG: | 0PPMQ | FG07059.1 | ctr copper transporter family protein |
|---|---|---|---|
| SGD closest match: | S000001218 | CTR2 | Copper transport protein CTR2 |
| CGD closest match: | CAL0000189658 | CTR2 | Low-affinity Cu transporter |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02476_2 | 50.588% | 170 | 1.46e-51 | MCA_02476_2 |
| A0A060T4V9_BLAAD | 52.201% | 159 | 3.71e-43 | ARAD1C44748p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C44748g PE=4 SV=1 |
| UniRef50_A0A0B4IK08 | 47.170% | 159 | 7.49e-32 | CTR2 long splice variant (Fragment) n=13 Tax=Hypocreales TaxID=5125 RepID=A0A0B4IK08_9HYPO |
| A0A0J9XCD5_GEOCN | 40.994% | 161 | 5.17e-34 | Similar to Saccharomyces cerevisiae YHR175W CTR2 Putative low-affinity copper transporter of the vacuolar membrane OS=Geotrichum candidum GN=BN980_GECA08s00098g PE=4 SV=1 |
| A0A1E3PSJ2_9ASCO | 37.107% | 159 | 6.88e-30 | Ctr-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81360 PE=4 SV=1 |
| A0A1D8PEE7_CANAL | 42.857% | 147 | 2.66e-29 | Low-affinity Cu transporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTR2 PE=4 SV=1 |
| CTR2_YEAST | 38.889% | 162 | 2.03e-23 | Copper transport protein CTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR2 PE=1 SV=1 |
| A0A1E4TBF0_9ASCO | 38.365% | 159 | 1.21e-22 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28186 PE=4 SV=1 |
| Q6C5R6_YARLI | 38.843% | 121 | 1.67e-15 | YALI0E15796p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15796g PE=4 SV=1 |
| A0A167EJ76_9ASCO | 22.642% | 159 | 9.52e-09 | Ctr3p OS=Sugiyamaella lignohabitans GN=CTR3 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0093
Protein family membership
- Ctr copper transporter (IPR007274)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_01539_1 MDHSMHSSMDMGNGDMGHGDMGHGDMGHGGMGKGDMCSMNMIFTWSTDNLCVVFRWWHVRTRFDLLATLVAVVLLGMGYE YLKVLGSRLDARSAARYGSGRVPLLDESPAAAASASLDGPGGPLNASPYASSQPADRLRLSRALLYCFQVFYSFFLMLVF MTYNGWLMLAVTFGAFLGYYIWGYRQPSRRDMSCH
GO term prediction
Biological Process
GO:0035434 copper ion transmembrane transport
Molecular Function
GO:0005375 copper ion transmembrane transporter activity
Cellular Component
GO:0016021 integral component of membrane