Protein
MIA_01113_1
Length
234 amino acids
Browser: contig01:3189509-3190263-
Protein function
| EGGNOG: | 0PJZK | PEX11 | peroxisomal biogenesis factor |
|---|---|---|---|
| SGD closest match: | S000005507 | PEX11 | Peroxisomal membrane protein PMP27 |
| CGD closest match: | CAL0000200064 | PEX11 | Pex11p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00694_1 | 73.191% | 235 | 3.58e-106 | MCA_00694_1 |
| A0A0J9X8N3_GEOCN | 56.410% | 234 | 1.44e-70 | Similar to Saccharomyces cerevisiae YOL147C PEX11 Peroxisomal membrane protein required for medium-chain fatty acid oxidation and peroxisome proliferation OS=Geotrichum candidum GN=BN980_GECA05s07248g PE=4 SV=1 |
| A0A1E3PCJ6_9ASCO | 54.315% | 197 | 4.78e-65 | Peroxisomal biogenesis factor 11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48346 PE=4 SV=1 |
| UniRef50_A0A1E3PCJ6 | 54.315% | 197 | 1.30e-61 | Peroxisomal biogenesis factor 11 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PCJ6_9ASCO |
| Q6CD37_YARLI | 47.959% | 196 | 1.13e-58 | YALI0C04092p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C04092g PE=4 SV=1 |
| A0A060TGW7_BLAAD | 49.239% | 197 | 1.42e-50 | ARAD1D34188p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34188g PE=4 SV=1 |
| A0A1D8PQD7_CANAL | 40.690% | 145 | 1.83e-37 | Pex11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PEX11 PE=4 SV=1 |
| PEX11_YEAST | 32.773% | 238 | 1.49e-25 | Peroxisomal membrane protein PMP27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX11 PE=1 SV=2 |
| A0A1E4TKT1_9ASCO | 32.099% | 243 | 2.38e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22000 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0904
Protein family membership
- Peroxisomal biogenesis factor 11 (IPR008733)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_01113_1 MSLVANHPTLTHVVSMLEKTTGRDKILRTVQYFSRFFAYVLFKKGATKESIAFWKHLQAQVALSRKLFRVGKPFNHLKLA AKAYANKTQDPVLRATAVLRNVFYTGYFSIDSLVWLNTSKVYQIPNFKPIQKLGSRLWLIGILFNLVNSLRRYQLASLQE SALLAESEKDSALLKKVQIEKAAATHQFAWDALDSSIPTYALDLAPGLLDDGLVGLFGLITSIFGLKQQWRITA
GO term prediction
Biological Process
GO:0016559 peroxisome fission
Molecular Function
None predicted.
Cellular Component
GO:0005779 integral component of peroxisomal membrane