Protein
MIA_00330_1
Length
165 amino acids
Browser: contig01:954890-955461+
Protein function
| EGGNOG: | 0PMX5 | PGUG_04210 | prefoldin subunit |
|---|---|---|---|
| SGD closest match: | S000003310 | PAC10 | Prefoldin subunit 3 |
| CGD closest match: | CAL0000183866 | orf19.5985 | Prefoldin subunit 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01221_1 | 67.460% | 126 | 9.45e-61 | MCA_01221_1 |
| A0A0J9YHI3_GEOCN | 64.885% | 131 | 4.01e-59 | Prefoldin subunit 3 OS=Geotrichum candidum GN=BN980_GECA01s04883g PE=3 SV=1 |
| A0A1E3PMG2_9ASCO | 55.556% | 153 | 4.77e-53 | Prefoldin subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50547 PE=3 SV=1 |
| A0A060THT6_BLAAD | 49.333% | 150 | 4.76e-49 | Prefoldin subunit 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40546g PE=3 SV=1 |
| UniRef50_A0A060THT6 | 49.333% | 150 | 1.18e-45 | Prefoldin subunit 3 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060THT6_BLAAD |
| A0A1E4TF12_9ASCO | 45.578% | 147 | 5.51e-45 | Prefoldin subunit 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1989 PE=3 SV=1 |
| Q6CFA5_YARLI | 55.118% | 127 | 1.68e-44 | Prefoldin subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08844g PE=3 SV=1 |
| A0A1D8PK48_CANAL | 52.344% | 128 | 3.63e-42 | Prefoldin subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5985 PE=3 SV=1 |
| PFD3_YEAST | 48.529% | 136 | 2.87e-34 | Prefoldin subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC10 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3332
Protein family membership
- Prefoldin alpha-like (IPR004127)
- Prefoldin subunit 3 (IPR016655)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02996 (Prefoldin)
-
-
-
PIRSF016396 (Prefol...)
-
no IPR
Unintegrated signatures
Protein sequence
>MIA_00330_1 MLTPKLISHLSTIDTLPFLSHSFHSNFHVQQTSTSQRVANLQVKIPDIEKTLDMVRFLESKKDSDKVITTNYGLNDSLYT KAEITPTNVVYLWLGANVMLEYTIDEAITLLNQRLDVAQKSLKSCEEDLEFLRENITTVEVNIARVYNWEVQKRREQREK EEESK
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
None predicted.
Cellular Component
GO:0016272 prefoldin complex