Protein
MIA_00015_1
Length
220 amino acids
Browser: contig01:37079-37742-
Protein function
| EGGNOG: | 0PGDV | FG10276.1 | nadh-ubiquinone oxidoreductase |
|---|---|---|---|
| CGD closest match: | CAL0000184766 | FESUR1 | Fesur1p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05603_1 | 98.204% | 167 | 5.62e-112 | MCA_05603_1 |
| A0A167DCB9_9ASCO | 95.808% | 167 | 9.83e-110 | Putative mitochondrial Complex I, NUKM_20kd subunit OS=Sugiyamaella lignohabitans GN=AWJ20_1021 PE=3 SV=1 |
| A0A0J9YH70_GEOCN | 94.012% | 167 | 7.72e-108 | NUKM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA01s00098g PE=3 SV=1 |
| A0A060SVV1_BLAAD | 91.018% | 167 | 9.46e-106 | ARAD1A00396p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00396g PE=3 SV=1 |
| A0A1E4TGW7_9ASCO | 91.018% | 167 | 5.18e-103 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31803 PE=3 SV=1 |
| UniRef50_J3NG92 | 89.024% | 164 | 4.96e-96 | NADH-ubiquinone oxidoreductase 19.3 kDa subunit n=10 Tax=leotiomyceta TaxID=716546 RepID=J3NG92_GAGT3 |
| Q5ADP7_CANAL | 84.940% | 166 | 2.74e-97 | Fesur1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FESUR1 PE=3 SV=1 |
| Q6C2Q1_YARLI | 93.846% | 130 | 9.11e-78 | YALI0F06050p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06050g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8804
Predicted cleavage: 41
Protein family membership
- NADH-ubiquinone oxidoreductase, 20 Kd subunit (IPR006138)
Domains and repeats
-
Domain
1
50
100
150
220
Detailed signature matches
-
-
PF01058 (Oxidored_q6)
-
-
Protein sequence
>MIA_00015_1 MLSRSLAPIARASLPSSSSLVLRTATKASPTLIALSSTRSASSLSKHTSSLPTDYPLASQQKPSSVVDYALTTLDAIANW ARQGSFWPVTFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPEPRWVISMGSC ANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGVFQLQKKMRNQKITRMWYRK
GO term prediction
Biological Process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0048038 quinone binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Cellular Component
None predicted.
no IPR