Protein
MCA_06295_1
Length
121 amino acids
Browser: contigD:3785760-3786217-
RNA-seq: read pairs 931, FPKM 94.3, percentile rank 77.6% (100% = highest expression)
Protein function
| KEGG: | K09548 | PFDN1 | prefoldin subunit 1 |
|---|---|---|---|
| SGD closest match: | S000003715 | PFD1 | Prefoldin subunit 1 |
| CGD closest match: | CAL0000200924 | orf19.3687 | Prefolding complex chaperone subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XB75_GEOCN | 51.26% | 119 | 6e-40 | Similar to Saccharomyces cerevisiae YJL179W PFD1 Subunit of heterohexameric prefoldin OS=Geotrichum candidum GN=BN980_GECA07s04740g PE=4 SV=1 |
| UniRef50_A0A0J9XB75 | 51.26% | 119 | 1e-36 | Similar to Saccharomyces cerevisiae YJL179W PFD1 Subunit of heterohexameric prefoldin n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XB75_GEOCN |
| MIA_06299_1 | 48.39% | 124 | 1e-35 | MIA_06299_1 |
| A0A161HHD0_9ASCO | 42.72% | 103 | 3e-23 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3027 PE=4 SV=1 |
| A0A1E3PSK8_9ASCO | 36.70% | 109 | 2e-16 | Prefoldin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49054 PE=4 SV=1 |
| A0A060TC30_BLAAD | 39.42% | 104 | 8e-16 | ARAD1D32802p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32802g PE=4 SV=1 |
| Q59VX1_CANAL | 30.51% | 118 | 3e-14 | Prefolding complex chaperone subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3687 PE=4 SV=1 |
| Q6CBT0_YARLI | 31.31% | 99 | 4e-09 | YALI0C15829p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C15829g PE=4 SV=1 |
| PFD1_YEAST | 30.11% | 93 | 3e-07 | Prefoldin subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFD1 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2337
Protein family membership
- Prefoldin beta-like (IPR002777)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MCA_06295_1 MSLPPEVLQKTLSDMQFKILSTSTEMQAVQQQEATILRKIRLSETTEKQINELTQNKPDTTVWKGVGKMFLSTTVADQIQ DLEKERKEYQEQLSALKKKQNYLENTYKNLTSAFQNISVGK
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex