Protein
MCA_05929_1
Length
68 amino acids
Gene name: TFB5
Description: RNA polymerase II transcription factor B subunit 5
Browser: contigD:2791713-2792091+
RNA-seq: read pairs 817, FPKM 146.3, percentile rank 84.6% (100% = highest expression)
Protein function
| Annotation: | TFB5 | RNA polymerase II transcription factor B subunit 5 | |
|---|---|---|---|
| KEGG: | K10845 | TTDA | TFIIH basal transcription factor complex TTD-A subunit |
| EGGNOG: | 0PQU4 | TFB5 | Component of the general transcription and DNA repair factor IIH (TFIIH), which is essential for both basal and activated transcription, as well as for nucleotide excision repair (NER) of DNA. TFB5 is required for stable recruitment of TFIIH to a promoter, but not for stability of TFIIH subunits (By similarity) |
| SGD closest match: | S000007603 | TFB5 | RNA polymerase II transcription factor B subunit 5 |
| CGD closest match: | CAL0000181098 | TFB5 | RNA polymerase II transcription factor B subunit 5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X4I1_GEOCN | 88.24% | 68 | 2e-39 | Similar to Saccharomyces cerevisiae YDR079C-A TFB5 Component of the RNA polymerase II general transcription and DNA repair factor TFIIH OS=Geotrichum candidum GN=BN980_GECA01s09679g PE=4 SV=1 |
| MIA_00693_1 | 88.24% | 68 | 2e-39 | MIA_00693_1 |
| A0A1E3PHL8_9ASCO | 80.95% | 63 | 1e-33 | Component of the RNA polymerase II general transcription and DNA repair factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51511 PE=4 SV=1 |
| A0A060TID9_BLAAD | 67.69% | 65 | 5e-29 | ARAD1D45782p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45782g PE=4 SV=1 |
| TFB5_YARLI | 61.76% | 68 | 1e-26 | RNA polymerase II transcription factor B subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB5 PE=3 SV=1 |
| UniRef50_A0A1L0BHK8 | 58.21% | 67 | 3e-22 | CIC11C00000000403 n=1 Tax=[Candida] intermedia TaxID=45354 RepID=A0A1L0BHK8_9ASCO |
| TFB5_YEAST | 60.29% | 68 | 2e-25 | RNA polymerase II transcription factor B subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB5 PE=1 SV=1 |
| TFB5_CANAL | 55.88% | 68 | 3e-23 | RNA polymerase II transcription factor B subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TFB5 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1529
Protein family membership
- TFIIH subunit TTDA/Tfb5 (IPR009400)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_05929_1 MPSAIKGVLIECDPSIRALILNIDSQTHDIIIEELDDTHLLVDENRVEYIKAELNKLLAKNTFVPEDE
GO term prediction
Biological Process
GO:0006289 nucleotide-excision repair
GO:0006355 regulation of transcription, DNA-templated
Molecular Function
None predicted.
Cellular Component
GO:0000439 core TFIIH complex