Protein
MCA_05472_1
Length
70 amino acids
Gene name: RTC6
Description: 54S ribosomal protein RTC6, mitochondrial
Browser: contigD:1408969-1409258-
RNA-seq: read pairs 1433, FPKM 249.4, percentile rank 90.4% (100% = highest expression)
Protein function
| Annotation: | RTC6 | 54S ribosomal protein RTC6, mitochondrial | |
|---|---|---|---|
| KEGG: | K02919 | RP-L36 | large subunit ribosomal protein L36 |
| EGGNOG: | 0PTCU | ribosomal protein | |
| SGD closest match: | S000007224 | RTC6 | 54S ribosomal protein RTC6, mitochondrial |
| CGD closest match: | CAL0000201459 | orf19.760 | Ribosomal protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05854_1 | 74.65% | 71 | 2e-34 | MIA_05854_1 |
| A0A0J9XKN7_GEOCN | 68.57% | 70 | 1e-29 | Ribosomal protein OS=Geotrichum candidum GN=BN980_GECA24s00252g PE=3 SV=1 |
| UniRef50_A0A0J9XKN7 | 68.57% | 70 | 3e-26 | Ribosomal protein n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XKN7_GEOCN |
| A0A060TBP4_BLAAD | 64.29% | 70 | 2e-23 | Ribosomal protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D33638g PE=3 SV=1 |
| RTC6_YEAST | 60.66% | 61 | 1e-19 | 54S ribosomal protein RTC6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC6 PE=1 SV=1 |
| Q59VH3_CANAL | 52.86% | 70 | 8e-17 | Ribosomal protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.760 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9963
Predicted cleavage: 52
Protein family membership
- Ribosomal protein L36 (IPR000473)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_05472_1 MWSLLRNSFAAAARPGFASSFIQQPFLTQIRGMKVRSSVKKFCSGCYIVRRKGRTYVYCKSNPKHKQRQG
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome