Protein
MCA_05099_1
Length
67 amino acids
Description: Putative ATP synthase subunit, mitochondrial
Browser: contigD:355576-356207-
RNA-seq: read pairs 14706, FPKM 2672.2, percentile rank 98.2% (100% = highest expression)
Protein function
| Annotation: | Putative ATP synthase subunit, mitochondrial | ||
|---|---|---|---|
| KEGG: | K02135 | ATPeF1E | F-type H+-transporting ATPase subunit epsilon |
| EGGNOG: | 0PS16 | Mitochondrial ATP synthase epsilon chain domain-containing protein | |
| SGD closest match: | S000006192 | ATP15 | ATP synthase subunit epsilon, mitochondrial |
| CGD closest match: | CAL0000195314 | orf19.5597.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04752_1 | 76.00% | 50 | 6e-22 | MIA_04752_1 |
| UniRef50_B6H9L9 | 55.38% | 65 | 2e-17 | Pc16g11100 protein n=118 Tax=Fungi TaxID=4751 RepID=B6H9L9_PENRW |
| A0A0J9XHS7_GEOCN | 57.63% | 59 | 7e-18 | Similar to Saccharomyces cerevisiae YPL271W ATP15 Epsilon subunit of the F1 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA15s02155g PE=4 SV=1 |
| A0A1E3PUC9_9ASCO | 53.45% | 58 | 1e-15 | Mitochondrial ATP synthase epsilon chain domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49199 PE=4 SV=1 |
| A0A060T0H1_BLAAD | 49.15% | 59 | 3e-13 | ARAD1C13277p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C13277g PE=4 SV=1 |
| A0A1D8PQ38_CANAL | 39.66% | 58 | 9e-09 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5597.1 PE=4 SV=1 |
| ATP5E_YEAST | 33.90% | 59 | 1e-06 | ATP synthase subunit epsilon, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP15 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9229
Predicted cleavage: 24
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Residue annotation
-
gamma subunit inte...
-
delta subunit inte...
Protein sequence
>MCA_05099_1 MSVSWKKAGFTYNRYLAIAARTVRNALKEEKRVANSGRSNLETRFAKWENGKQEDYTPVSFTNSKTA
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0000275 mitochondrial proton-transporting ATP synthase complex, catalytic core F(1)