Protein
MCA_04485_1
Length
88 amino acids
Gene name: TIM11
Description: ATP synthase subunit e, mitochondrial
Browser: contigC:3155132-3155589+
RNA-seq: read pairs 7809, FPKM 1084.1, percentile rank 96.7% (100% = highest expression)
Protein function
| Annotation: | TIM11 | ATP synthase subunit e, mitochondrial | |
|---|---|---|---|
| KEGG: | K01549 | TIM11 | F-type H+-transporting ATP synthase subunit e |
| EGGNOG: | 0PS6S | FG00429.1 | ATP synthase E chain |
| SGD closest match: | S000007255 | TIM11 | ATP synthase subunit e, mitochondrial |
| CGD closest match: | CAL0000181686 | orf19.5660.1 | F1F0 ATP synthase subunit e |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01178_1 | 76.14% | 88 | 2e-37 | MIA_01178_1 |
| A0A0J9X5A1_GEOCN | 71.11% | 90 | 1e-31 | Similar to Saccharomyces cerevisiae YDR322C-A TIM11 Subunit of mitochondrial F1F0-ATPase OS=Geotrichum candidum GN=BN980_GECA02s03332g PE=4 SV=1 |
| B5FVG3_YARLI | 55.42% | 83 | 3e-22 | YALI0E32164p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32164g PE=4 SV=1 |
| UniRef50_B5FVG3 | 55.42% | 83 | 7e-19 | YALI0E32164p n=3 Tax=Dipodascaceae TaxID=34353 RepID=B5FVG3_YARLI |
| A0A1E3PG50_9ASCO | 45.98% | 87 | 3e-14 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83888 PE=4 SV=1 |
| ATPJ_YEAST | 37.93% | 87 | 4e-13 | ATP synthase subunit e, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM11 PE=1 SV=2 |
| A0A1D8PL02_CANAL | 41.57% | 89 | 2e-11 | F1F0 ATP synthase subunit e OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5660.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6990
Predicted cleavage: 13
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_04485_1 MSSAPVLNVFRWGALGAGVVYGFVHNLTLSSQAEEQKAAKEYARKEALIKEAKAKYAELHPKPVSKDGPVNFDDPNFDLE AYITKALS
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)