Protein
MCA_04063_1
Length
110 amino acids
Gene name: SUI1
Description: Eukaryotic translation initiation factor eIF-1
Browser: contigC:1929591-1930000-
RNA-seq: read pairs 7649, FPKM 851.5, percentile rank 96.2% (100% = highest expression)
Protein function
| Annotation: | SUI1 | Eukaryotic translation initiation factor eIF-1 | |
|---|---|---|---|
| KEGG: | K03113 | EIF1 | translation initiation factor 1 |
| EGGNOG: | 0PNPS | SUI1 | Translation initiation factor |
| SGD closest match: | S000005188 | SUI1 | Eukaryotic translation initiation factor eIF-1 |
| CGD closest match: | CAL0000195380 | SUI1 | Translation initiation factor eIF1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06186_1 | 89.09% | 110 | 5e-69 | MIA_06186_1 |
| A0A167CUC3_9ASCO | 85.45% | 110 | 2e-65 | Translation initiation factor eIF1 OS=Sugiyamaella lignohabitans GN=SUI1 PE=4 SV=1 |
| A0A060TA05_BLAAD | 84.55% | 110 | 2e-64 | ARAD1D19338p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19338g PE=4 SV=1 |
| Q6CCQ3_YARLI | 77.27% | 110 | 1e-59 | YALI0C07524p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C07524g PE=4 SV=1 |
| UniRef50_Q6CCQ3 | 77.27% | 110 | 3e-56 | YALI0C07524p n=130 Tax=Eukaryota TaxID=2759 RepID=Q6CCQ3_YARLI |
| A0A1E3PNH7_9ASCO | 70.00% | 110 | 8e-58 | Translation initiation factor SU OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22949 PE=4 SV=1 |
| SUI1_YEAST | 74.77% | 107 | 2e-57 | Eukaryotic translation initiation factor eIF-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI1 PE=1 SV=1 |
| A0A0J9X3W5_GEOCN | 83.64% | 110 | 6e-57 | Similar to Saccharomyces cerevisiae YNL244C SUI1 Translation initiation factor eIF1 OS=Geotrichum candidum GN=BN980_GECA02s02529g PE=4 SV=1 |
| Q59LQ6_CANAL | 70.00% | 110 | 7e-47 | Translation initiation factor eIF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUI1 PE=4 SV=1 |
| A0A1E4TKX4_9ASCO | 51.79% | 112 | 2e-30 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_86486 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0863
Protein family membership
- Eukaryotic translation initiation factor SUI1 (IPR005874)
Domains and repeats
-
Domain
1
20
40
60
80
100
110
Detailed signature matches
-
-
PIRSF004499 (Transl...)
-
cd11566 (eIF1_SUI1)
-
-
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Residue annotation
-
rRNA binding site ...
-
Mutations affectin...
Protein sequence
>MCA_04063_1 MSTSIENLKSFDPFADTGDDETHSPDHIHIRLQQRNGRKTITTVQGIPQEYDLKRILKVLKKDFGCNGHITKDEELGDIL QLQGDQRQKVTDFLTSQLEIDKKVIQVHGF
GO term prediction
Biological Process
GO:0006413 translational initiation
Molecular Function
GO:0003743 translation initiation factor activity
Cellular Component
None predicted.