Protein
MCA_04032_1
Length
352 amino acids
Browser: contigC:1813145-1814430+
RNA-seq: read pairs 1435, FPKM 50.2, percentile rank 65.5% (100% = highest expression)
Protein function
| EGGNOG: | 0PFBD | PGUG_04039 | Mitochondrial cation transporter |
|---|---|---|---|
| SGD closest match: | S000005797 | FSF1 | Probable mitochondrial transport protein FSF1 |
| CGD closest match: | CAL0000177270 | orf19.4811 | Probable mitochondrial transport protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00958_1 | 73.86% | 352 | 2e-179 | MIA_00958_1 |
| A0A0J9XGN7_GEOCN | 70.90% | 354 | 5e-168 | Probable mitochondrial transport protein OS=Geotrichum candidum GN=BN980_GECA15s03189g PE=3 SV=1 |
| A0A167CPL6_9ASCO | 70.45% | 352 | 1e-165 | Probable mitochondrial transport protein OS=Sugiyamaella lignohabitans GN=FSF1 PE=3 SV=1 |
| A0A1E4TM60_9ASCO | 64.02% | 353 | 4e-153 | Probable mitochondrial transport protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1411 PE=3 SV=1 |
| FSF1_YEAST | 64.20% | 352 | 6e-150 | Probable mitochondrial transport protein FSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSF1 PE=1 SV=1 |
| UniRef50_Q12029 | 64.20% | 352 | 2e-146 | Probable mitochondrial transport protein FSF1 n=98 Tax=Ascomycota TaxID=4890 RepID=FSF1_YEAST |
| A0A060TBV1_BLAAD | 67.33% | 352 | 5e-149 | Probable mitochondrial transport protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D30580g PE=3 SV=1 |
| Q5APF5_CANAL | 62.89% | 353 | 3e-147 | Probable mitochondrial transport protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4811 PE=3 SV=1 |
| Q6CEF5_YARLI | 64.87% | 353 | 2e-146 | Probable mitochondrial transport protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B16060g PE=3 SV=1 |
| A0A1E3PP25_9ASCO | 63.84% | 318 | 2e-125 | Tricarboxylate carrier OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45361 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0359
Predicted cleavage: 19
Protein family membership
- Tricarboxylate/iron carrier (IPR004686)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_04032_1 MASSVPGFRPLPASRYDLDTYWGRVKHCAELSDPRMLLHTSEEIESAKKLISQYRTGQLPPQMTPELWRAKQVLDSTLHP DTGTPVMLPFRMSSYVLSNLVVTVGMLTPNMGTAGTLFWQIANQSLNVAVNTANANKSHPLTTQQLITSYLLAVSGSCGV ALGLNAIVPRLKNVSANTRSILSRLVPFAAVVSAGMVNVALMRGEEMRRGISVYYTKQSKKEAEASKEQEVQHEGDDVVH ENVNLGTSKRAAKLAVGETALSRVINATPVMVIPPLLLLQLQKSVLKGKSMLTVTLANLGLITVTSFAVLPFALAIFPQT IHISPKVLEEQFHDLKDEEGKPIEKVWFNRGM
GO term prediction
Biological Process
GO:0006811 ion transport
GO:0055085 transmembrane transport
Molecular Function
GO:0015075 ion transmembrane transporter activity
Cellular Component
GO:0016020 membrane