Filter view on
Entry type
Status
Per-residue features
Colour by
Protein
MCA_04025_1
Length
610 amino acids
Gene name: MDR1A
Description: Multidrug resistance protein 1
Browser: contigC:1799067-1800900+
RNA-seq: read pairs 21, FPKM 0.4, percentile rank 6.5% (100% = highest expression)
Protein function
| Annotation: | MDR1A | Multidrug resistance protein 1 | |
|---|---|---|---|
| KEGG: | K08158 | MDR1 | MFS transporter, DHA1 family, multidrug resistance protein |
| EGGNOG: | 0QDYJ | FG02865.1 | resistance protein |
| SGD closest match: | S000000212 | FLR1 | Fluconazole resistance protein 1 |
| CGD closest match: | CAL0000173998 | MDR1 | Multidrug resistance protein 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05930_1 | 60.62% | 612 | 0.0 | MIA_05930_1 |
| A0A0J9XL11_GEOCN | 51.47% | 614 | 0.0 | Similar to Saccharomyces cerevisiae YBR008C FLR1 Plasma membrane multidrug transporter of the major facilitator superfamily OS=Geotrichum candidum GN=BN980_GECA27s00021g PE=4 SV=1 |
| UniRef50_A0A0J9X5S8 | 50.65% | 612 | 0.0 | Similar to Saccharomyces cerevisiae YBR008C FLR1 Plasma membrane multidrug transporter of the major facilitator superfamily n=3 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5S8_GEOCN |
| A0A1E3PJA3_9ASCO | 43.97% | 614 | 4e-162 | SCR1 protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47140 PE=4 SV=1 |
| A0A060T943_BLAAD | 42.56% | 618 | 3e-152 | ARAD1D12672p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D12672g PE=4 SV=1 |
| Q6C0D8_YARLI | 39.57% | 609 | 1e-140 | YALI0F25597p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F25597g PE=4 SV=1 |
| MDR1_CANAL | 46.71% | 471 | 3e-133 | Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=2 |
| A0A167CAG3_9ASCO | 41.60% | 524 | 5e-117 | Flr1p OS=Sugiyamaella lignohabitans GN=FLR1 PE=4 SV=1 |
| FLR1_YEAST | 39.02% | 469 | 2e-99 | Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 |
| A0A1E4TIX5_9ASCO | 34.39% | 471 | 2e-72 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14557 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6883
Protein family membership
- Major facilitator superfamily (IPR011701)
Domains and repeats
-
Domain156 - 603
- Major facilitator superfamily domain (IPR020846)
1
100
200
300
400
500
610
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)531 - 536289 - 294228 - 238601 - 6101 - 170350 - 396463 - 482
-
164 - 365397 - 604
-
NON_CYTOPLASM... (N...)260 - 264191 - 209560 - 578424 - 442500 - 504317 - 327
-
509 - 531477 - 499397 - 419575 - 597172 - 194538 - 560442 - 464265 - 287209 - 231240 - 259326 - 348294 - 316
-
TRANSMEMBRANE (Tran...)295 - 316171 - 190537 - 559210 - 227505 - 530397 - 423483 - 499328 - 349579 - 600239 - 259443 - 462265 - 288
-
mobidb-lite (disord...)51 - 85
Residue annotation
-
putative substrate...188Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)191Yputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)192Tputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)193Pputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)195Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)196Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)213Lputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)216Fputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)217Vputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)220Yputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)224Pputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)225Mputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)227Lputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)228Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)276Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)277Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)280Lputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)281Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)284Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)285Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)288Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)300Lputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)301Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)303Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)304Iputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)310Pputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)416Yputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)419Iputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)420Nputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)423Fputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)424Eputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)427Pputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)441Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)445Yputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)449Iputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)452Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)456Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)516Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)519Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)520Iputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)523Fputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)527Fputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)528Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)531Gputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)542Yputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)543Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)546Cputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)549Rputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)550Sputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)553Aputative substrate translocation pore
188S, 191Y, 192T, 193P, 195A, 196A, 213L, 216F, 217V, 220Y, 224P, 225M, 227L, 228S, 276A, 277S, 280L, 281S, 284G, 285A, 288G, 300L, 301A, 303S, 304I, 310P, 416Y, 419I, 420N, 423F, 424E, 427P, 441G, 445Y, 449I, 452G, 456G, 516S, 519G, 520I, 523F, 527F, 528A, 531G, 542Y, 543A, 546C, 549R, 550S, 553A
CDD
cd06174 (MFS)
Protein sequence
>MCA_04025_1 MASDLIRESAVGFFINKFSKGKILPYTEEKPDFVVPQRYLEDPPLLSRQRSLASSIHSNHQTHQYTTEVESPESKPESFK GFDSDGTRVESLYHEKSDQSDDEENGLCEKPVAYTTENCENIVELKPYKSQDPLASPDDSRSTDHGQYIVVDWYGPDDKD NPKNWPAWKKLWTVFAIAFLTVSIYMGSSIYTPGAAQIMSDLNTTRTKAVLPLTMFVIGYGVGPMVLSPLSEHPPLGRTF LYIINLALFCILQVPIALAKNVETIIGLRFLAGVFASPALSTGGATVGDVLSEHMFVGLLAWSIGAFCGPTFGPLIGGVF SQLVSWRWTFWFLCCISGFALAILSVFLPETNHATILHRRAARLRKLTGNMAIRSSFEVQEKQTTTELIKDTLWRPIVII FEPIVTCLNIYSAFIYIVINSWFESLPIVFNEFYKFNLIEGGLVYLAAIVGGLIGGCFYYYTYNRINKSNNPNIEKYLIP AKIGAFFLPVALFIFSWGTSTETHWMAPVSSLTIFSIGGIFIFQSIFAYLGKGFPRFLASVYAGNCLVRSVSASVFPLFT HSMYARLAREKFPVALAGTIWACISVLMIAIPFLISHYGVRLRGRSKYAN
GO term prediction
Biological Process
GO:0055085 transmembrane transport
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane