Protein
MCA_03992_1
Length
86 amino acids
Browser: contigC:1716198-1716534-
RNA-seq: read pairs 172, FPKM 24.4, percentile rank 47.0% (100% = highest expression)
Protein function
| SGD closest match: | S000007624 | YNL162W-A | Uncharacterized protein YNL162W-A |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XFC6_GEOCN | 54.84% | 62 | 6e-18 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA13s00983g PE=4 SV=1 |
| UniRef50_A0A0J9XFC6 | 54.84% | 62 | 1e-14 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XFC6_GEOCN |
| A0A1E3PDC1_9ASCO | 43.94% | 66 | 2e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84524 PE=4 SV=1 |
| YN162_YEAST | 35.09% | 57 | 4e-09 | Uncharacterized protein YNL162W-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL162W-A PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0348
Protein family membership
None predicted.
Domains and repeats
None predicted.
Protein sequence
>MCA_03992_1 MSENLTLEQNDNQPIITTCPKCKSLLKRCLIDEHNAVTICPVLTCAYPFSESPENLQITKVSEKEVLDNVAGRMARANLD PTGLKQ
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.